Conceptio › Archive › ClinicalTrials.gov
ClinicalTrials.govpublic full text

hCAP18 Levels and Vitamin D Deficiency in Chronic Kidney Disease

Massachusetts General Hospital
ClinicalTrials.gov · Datasets · License: Public Domain
Open Source ↗
chronickidneydiseasevitaminddeficiency
chronic kidney disease, vitamin d deficiency
This document is indexed with metadata only — full text is not available in the archive for this record. Open the official source ↗
Record · ID 141209
Retrieved via Conceptio — every document is proof-bundled with source, license, and retrieval metadata.