ConceptioArchivearXiv CS
arXiv CSopen access

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

Unknown · 2026 · arxiv_cs
arXiv CS · Papers · License: Open Access · 2026
Open Source ↗Direct PDF ↓
artificialintelligenceknowledgerepresentationreasoning
artificial intelligence, reasoning, knowledge representation

SII-GAIR

2026-07-28

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data Zhen Huang1,3,4 , Yikun Wang1,3,4 , Shijie Xia2,3,4 and Pengfei Liu2,3,4 Corresponding author, 1 Fudan University, 2 Shanghai Jiao Tong University, 3 SII, 4 GAIR

arXiv:2607.24717v1 [cs.CL] 27 Jul 2026

Code: https://github.com/GAIR-NLP/DataOrchestra Pretraining data processing is critical to the downstream performance of Large Language Models (LLMs). However, many existing approaches define a fixed processing strategy at the corpus or domain level and apply it uniformly to many examples, without adapting to the needs of each example. We propose DataOrchestra, a framework that unifies different processing operations and orchestrates an example-specific pipeline for each example. Given a chunk of pretraining data, an orchestrator decides whether to drop, untouch, or clean it. For a chunk to be cleaned, it selects one or more downstream operations, ranging from programmatic editing to different forms of LLM-based rewriting. For each rewriting step, it further generates a concrete instruction, which is executed by the corresponding downstream tool model. We pretrain models from 0.5B to 7B from scratch on web data processed by DataOrchestra and observe stable average gains over individual data-processing methods across 11 benchmarks. DataOrchestra is also effective for math continued pretraining and outperforms stronger processing baselines, while reducing processing compute by skipping unnecessary downstream operations.

1. Introduction Large Language Models (LLMs) are increasingly used to process pretraining data because of their flexibility in handling diverse text. Some methods score and filter entire low-quality documents (Engstrom et al., 2024; Peng et al., 2025; Wettig et al., 2024; Yu et al., 2024), while others perform finer-grained processing within documents, which we group into three types. At the lightest level, LLMs generate programs that edit line-level noise, such as ads and boilerplate, without rewriting the entire text; we call this noise pruning (NP) (Bi et al., 2025; Zhou et al., 2024). With stronger intervention, LLMs rewrite the entire text to repair formatting, grammar, tables, or other surface-level issues while preserving the original content, which we term surface rectification (SR) (Maini et al., 2024; Nguyen et al., 2025; Yu and Xiong, 2025). At the strongest level, LLMs rewrite knowledgeor reasoning-intensive data, such as math or Wikipedia text, to add explanations or improve its educational value, which we term pedagogical augmentation (PA) (Fujii et al., 2025; Qin et al., 2026; Team et al., 2025). Together, these methods cover a wide range of data-processing needs, but no existing framework integrates them and adaptively decides, for each example, which operations to use and how each should be applied. Specifically, existing methods have three main limitations. First, many methods focus on a single data-processing operation, but a single operation cannot address all types of data issues. For example, programmatic noise pruning methods like ProX (Zhou et al., 2024) can remove line-level noise but cannot repair more complex corruption that requires rewriting (Figure 1a). Second, even methods that combine multiple operations often apply the same multi-stage pipeline to diverse examples. However, different examples require different treatments: some low-quality examples should be dropped rather than repaired (Maini et al., 2025; Niklaus et al., 2026), some high-quality ones should remain untouched to avoid over-deletion (Bi et al., 2025) or hallucination (Huang et al., 2025), and

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

(b)

(a) raw text

NP

Unable to process only with NP

[000] HomeArticlesSign in&nbsp; >clickhere1111111 [001] ##Photo synthe sis&nbsp; [002] is how\n plant sconvert</p> [003] sun lightinto**energy**.\\It happen ;br&gt;in... [010] <div>Ads by Google</div>11111111111111111

Photosynthesis is how plants convert sunlight into energy. It happens in ...

SR

1 Input >> Home | Search | Sign in Photosyn the sis ... plant s convert ... sun light into **energy** .... Item Price Pen $1 Book $3 ... def add(a,b): return a+b print(add(2,3)) ... E = mc^2 ... ...

raw text

NP

≥ 98% NP

SR

Similarity Check PA

Multi-Stage Pipeline

2 Orchestrator

3

(c) [000] Share | Print |111 [001] Subscribe | Sign in [002] The French Revolution began in 1789.

Plan

The French Revolution broke out in 1789.

Wasted compute

4

Prompt: Clean and rewrite into fluent text

Photo synthe sis ... plant s convert ... sun light into **energy** ...

def bubble(a): for i in range(len(a)): for j in range(len(a)-1): …

Photosynthesis is how plants convert sunlight into energy …

The function bubble takes a list and iterates over its Elements ...

Loss of Code Snippet

Adaptive Pipeline

5

Output

Photosynthesis is how plants convert sunlight into energy.

Drop

NP

SR

PA

Untouch

| Item | Price | |------ |-------- | | Pen | $1 | | Book | $3 |

Clean

def add(a, b): return a + b print(add(2, 3))

Instruction

Clean residual HTML and non-semantic characters (e.g., &gt;, &nbsp;, <div>, <br>), rejoin broken tokens and …

E = mc² Energy equals mass times the speed of light squared.

Figure 1 | Top: limitations of existing pretraining-data curation that motivate our design. Bottom: the overview of our DataOrchestra framework. others may require only a subset of processing stages. Applying the full pipeline to every example can therefore waste compute with little additional benefit (Figure 1b). Third, when LLM-based rewriting is needed, most methods use a shared prompt across diverse examples. Yet different examples may require different rewriting goals, so one general prompt cannot fit all cases (Figure 1c). Recent work explores different rewriting strategies across different domains (Mi et al., 2026), but such adaptation remains coarse-grained. In short, these limitations motivate a framework that can unify different processing operations, select an example-specific subset of them, and further adapt each rewriting step to the content being processed. To fill this gap, we propose DataOrchestra, a framework that orchestrates an example-specific processing pipeline for each data example, as shown in the bottom of Figure 1. Given a chunk, the orchestrator first decides whether to drop, untouch, or clean it. For a chunk to be cleaned, it selects which processing stages to apply and orchestrates them into an adaptive pipeline. For each stage involving LLM rewriting, the orchestrator further generates a concrete, example-specific instruction (e.g., which table to fix, which explanation to add), which is passed to the downstream tool model that actually performs the operation. To train the orchestrator, we first use a teacher LLM to propose an initial processing plan for each chunk. We then execute this plan with downstream tool models and verify the resulting changes. Based on the execution feedback, we evolve the initial plans by removing stages that produce only minimal changes or harm the original content, and by refining rewriting instructions when the output loses information, introduces factual errors, or still contains surface-level noise. This evolution grounds the plans in the actual behavior of downstream tool models rather than relying only on the teacher LLM’s high-level judgment. In this way, we construct 300K pairs of high-quality training samples and use them to fine-tune the orchestrator. To verify its effectiveness, we apply DataOrchestra to four common web datasets, RedPajamaV2 (Weber et al., 2024), DCLM-RefinedWeb (Li et al., 2024), C4 (Raffel et al., 2020), and FineWeb (Penedo et al., 2024), instantiated with tool models no larger than 4B: a 0.6B noise pruning model and a 4B rewrite model (Qwen3-4B). Pretraining models from scratch from 0.5B to 7B, we observe stable average gains over other single data-processing methods across 11 benchmarks. The same framework

2

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

also works on math continued pretraining setting, improving the quality of OpenWebMath (Paster et al., 2024) and MegaMath (Zhou et al., 2025) and yielding gains on scientific reasoning benchmarks. DataOrchestra further outperforms stronger baselines, including rewriting methods that filter and mix rewritten data with the original corpus using fastText, as well as several fixed multi-stage processing pipelines, while reducing overall processing compute. In summary, our contributions are as follows: • We propose DataOrchestra, a framework that orchestrates an example-specific processing pipeline for pretraining data. • We validate its effectiveness across multiple datasets, settings, and model sizes, and show that it improves data quality while saving compute by skipping unnecessary stages. • We will release the orchestrator model, together with the full scripts and code of the framework, to support further research by the community.

2. Related Work Pretraining Data Selection and Processing As pretraining scales to the trillion-token level, the community increasingly focuses on data quality over quantity (Gunasekar et al., 2023), since webcrawled data (e.g., CommonCrawl) is noisy and training on it directly wastes compute or hurts performance. Early work filters low-quality documents along dimensions such as language (Wenzek et al., 2020), web URLs (Penedo et al., 2023, 2024), and heuristic rules like length and character counts (Rae et al., 2021; Raffel et al., 2020), and removes duplicates through deduplication (Abbas et al., 2023; Lee et al., 2022). To improve selection, model-based approaches either train a binary fastText classifier (Joulin et al., 2017; Li et al., 2024) or a small model that scores quality along multiple dimensions (Peng et al., 2025; Wettig et al., 2024; Yu et al., 2024), though some work questions the necessity of filtering altogether (Mohri et al., 2026). Beyond document-level filtering, another line performs in-document refinement, using heuristic rules (Penedo et al., 2023; Rae et al., 2021) or a small LLM that edits text through programs (Bi et al., 2025; Zhou et al., 2024). Synthetic Pretraining Data Curation Using LLMs to clean and synthesize data has become common practice (Su et al., 2025). Rules or programs from lightweight models cannot fix complex issues such as broken tables, formulas, or grammar, whereas rewriting with LLMs can recycle such data: WRAP (Maini et al., 2024) and ReWire (Nguyen et al., 2025) rephrase data into specific formats, while RePro (Yu and Xiong, 2025) trains a faithful rewriter with reinforcement learning. Other work synthesizes diverse data through role-playing (Hao et al., 2025), knowledge-graph synthesis (Yang et al., 2024), and direct continuation (Ben Allal et al., 2024), and for knowledge- or reasoningintensive text, enhancing its educational value improves utility (Fujii et al., 2025; Qin et al., 2026; Team et al., 2025). However, synthetic data also risks model collapse (Gerstgrasser et al., 2024) or hallucinated and factual errors (Liu et al., 2024), and how to use it effectively remains open (Maini et al., 2025; Niklaus et al., 2026). Overall, existing methods either treat each operation in isolation or apply the same multi-stage pipeline to large amounts of data; none combines operations of different levels into a pipeline tailored to each example.

3

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

Table 1 | The operations in DataOrchestra, organized by the orchestrator’s two-level decision. At the top level, a chunk is assigned to drop, untouch, or clean; a clean chunk further passes through one or more of the three cleaning stages NP, SR, and PA, applied in this order. The last column lists representative prior work for each operation.

Decision

Operation

Operator

Relevant Methods

Drop

drop(c) → ∅

QuRating, MATES, DataMan

Untouch

untouch(c) → c

Clean

NP SR PA

np(c) → remove_lines(start, end) sr(c) → rewrite(instructions) pa(c) → rewrite(instructions)

ProX, RefineX WRAP, RePro ReWire, Darwin-Science

3. Methods 3.1. Task Formulation We treat pretraining data curation as a transformation over text applied at the level of chunks. Given a document 𝐷 from a corpus C, we segment it into an ordered sequence of chunks Split( 𝐷) = ( 𝑐1 , . . . , 𝑐𝑛 ), where each chunk holds at most 𝑊 tokens (we use 𝑊 = 10241 ). We process each chunk 𝑐𝑖 with its own pipeline 𝑃𝑖 = 𝑠1 → · · · → 𝑠𝑘 , an ordered composition of one or more stages. Formally, each stage 𝑠 maps a chunk to a new chunk and may return the empty string ∅ to delete it; an empty pipeline thus leaves a chunk unchanged, while a pipeline whose output is ∅ removes it. We then rebuild the ˆ = ˆ𝑐1 ∥ · · · ∥ ˆ𝑐𝑛 by concatenating the processed chunks ˆ𝑐𝑖 = 𝑃 𝑖 ( 𝑐𝑖 ) in their original refined document 𝐷 order and dropping any that were deleted. We organize data processing into three high-level decisions: Drop, Untouch, and Clean. Drop removes a chunk with no usable content (Peng et al., 2025; Wettig et al., 2024; Yu et al., 2024), while Untouch keeps it unchanged when no processing is needed. Clean applies one or more processing stages. We group cleaning operations into three stages with increasing levels of intervention. Noise Pruning (NP) uses a lightweight small LLM to generate programmatic edits that remove clearly worthless lines, such as boilerplate, ads, links, and navigation bars (Bi et al., 2025; Zhou et al., 2024). Surface Rectification (SR) uses an LLM to repair issues that line-level edits cannot fix, such as broken tables and formulas, grammatical errors, and disordered layout, while preserving the original meaning (Maini et al., 2024; Yu and Xiong, 2025). Pedagogical Augmentation (PA) rewrites knowledgeor reasoning-intensive text to improve its educational value by expanding existing points, adding relevant knowledge, and making the underlying reasoning more explicit (Fujii et al., 2025; Nguyen et al., 2025; Qin et al., 2026). A clean pipeline may contain any subset of these stages, applied in the order NP → SR → PA. 3.2. DataOrchestra Framework DataOrchestra centers on the orchestrator model, which decides how each chunk is processed and assigns the actual execution to a set of tool models. Given a chunk 𝑐, the orchestrator first makes a high-level decision among drop, untouch, and clean (Table 1). A drop decision removes the chunk and an untouch decision keeps it unchanged, ending its pipeline immediately. If the decision is clean, the orchestrator selects which of the three stages, NP, SR, and PA, the chunk passes through, and the 1 All token counts in this paper use the Qwen3 tokenizer.

4

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

Seed Data Collection

Plan Generation

Plan Evolution

Fine-tuning

Router Quality Scorer

NP NP Verifier Pass Fail

1-3 Public Dataset

4-5

SR

SFT

PA

Orchestrator

SR/PA Verifier Pass Fail

Decision

>=1 Instruction Generator

Drop Gate

160k Docs

Similarity < 98%

……

NP

True

SR

<instruction>

PA

null

example

300K Training Samples

Figure 2 | The overview of our orchestrator model training pipeline. chunk flows through the selected stages in order, each handled by its own tool model. For NP, the noise pruning tool model returns one or more remove_lines(start, end) operations that delete lines start to end; unlike ProX and RefineX, we keep only whole-line removal and drop in-line substring edits, which simplifies the duty of this small tool model. For SR and PA, the chunk is passed to the corresponding rewriting tool model with a two-part instruction: a general part, shared by all chunks routed to the stage, that states the basic rewriting principles, and a chunk-specific part that the orchestrator generates from the chunk, specifying what it needs, such as which formatting to repair for SR or which explanation to add for PA. 3.3. Orchestrator Model Training Figure 2 gives an overview of how we train the orchestrator. Starting from a pool of seed documents, we generate an initial coarse-grained plan for each chunk and evolve it into a fine-grained plan through actual tool-model execution and verification, yielding a chunk-specific instruction for every rewriting stage. We then fine-tune the orchestrator on the resulting data. Seed Data Collection We build the seed data for training the orchestrator from widely used public pretraining corpora: RedPajama-V2, DCLM-RefinedWeb, C4, and FineWeb for the general domain, and OpenWebMath and MegaMath for the science domain. We reserve a held-out portion of each corpus for orchestrator training and keep the rest for the pretraining experiments in Section 4; collection and sampling details are in Appendix A.1. Since a seed set dominated by clean documents would leave most chunks untouched and give little training signal, we score every document with DataMan (Peng et al., 2025), an LLM-based quality scorer that assigns a score from 1 to 5, and upsample low-quality documents so that those scored 1–3 and 4–5 form two equal-sized groups. This gives a final pool of 160K documents for orchestrator training. Coarse-grained Plan Generation For chunks from seed data, we use a teacher LLM2 to produce a coarse-grained plan in two steps. First, we decide whether to drop the chunk. Unlike prior methods that drop based on educational value or format score, we lower the threshold and discard a chunk only when it has no salvageable value, giving each chunk a better chance of being repaired: we prompt the teacher LLM to rate the chunk from 0 to 5 under a stricter rubric and drop it only when 2 All teacher LLMs and verifier LLMs (introduced later) used in this paper, including the one for retraining the ProX model, are Qwen3-235B-A22B-Instruct-2507.

5

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

the score is below 2. Second, for each surviving chunk, we ask the same teacher LLM for a binary judgment on each of NP, SR, and PA, indicating whether the chunk needs that stage; a chunk that receives all-False judgments is marked untouch. The drop decision, the untouch decision, and the three stage judgments together form the coarse-grained plan. Prompts are given in Appendix A.2. Fine-grained Plan Evolution A coarse plan still has two limitations. First, the teacher’s highlevel decisions may not match what the tool models actually do: a stage marked as necessary may change the chunk only marginally, or even damage it, for example by over-pruning non-noise lines or hallucinating during rewriting. Second, for the rewriting stages SR and PA, the coarse plan only decides whether a stage is applied, without specifying the rewrite goal or a chunk-specific instruction, so the rewriting stays generic rather than adaptive. To address both, we evolve each coarse plan by grounding it in actual tool-model execution. For a chunk marked for cleaning, we run the selected stages in order and verify each one with a verifier LLM, removing any stage that brings little or harmful change. We remove NP when it overprunes non-noise lines. For a rewriting stage, the verifier checks whether the rewrite removes the visible noise and preserves fidelity, i.e., introduces no hallucinated facts and loses no information; we remove it when it repeatedly fails these checks or barely changes the chunk (Levenshtein similarity above 98%). For a failed rewrite, the verifier produces a corrective instruction and the tool model retries under it, up to 𝑁 = 5 times. For a rewrite that passes on the first try, the verifier synthesizes the instruction from the before-and-after chunk. For the tool models, we follow Zhou et al. (2024) to train the NP model (like ProX-C) by fine-tuning Qwen3-0.6B-Base, keeping only the remove_lines(start, end) operation as in Section 3.2, and use the off-the-shelf Qwen3-4B (non-thinking) as the SR and PA model. Details are in Appendix A.3. Fine-tuning The procedure above yields about 300K pairs of training data. We use them to supervised fine-tune (SFT) the orchestrator from Qwen3-1.7B-Base: given a chunk as input, the model is trained to produce its data curation pipeline, that is, whether to drop or untouch the chunk, or, if it is cleaned, which of NP, SR, and PA the chunk passes through, together with the chunk-specific instruction for each SR or PA stage involved. Training hyper-parameters are provided in Appendix A.4. We also experiment with orchestrators of different sizes; as shown in Appendix A.5, the 1.7B model offers the best trade-off between overall performance and cost, so we adopt it as the default.

4. Experiments 4.1. Setup Baselines We select baselines that cover several types of data-processing methods. The first is a rule-based method, for which we combine the heuristic curation rules from C4 (Raffel et al., 2020), Gopher (Rae et al., 2021), and FineWeb (Penedo et al., 2024). The remaining baselines are model-based. ProX (Zhou et al., 2024) performs both data filtering and line-level editing. For a fair comparison, we retrain ProX models on Qwen3-0.6B-Base. We further include two rewriting baselines that use an LLM to rewrite the data. RePro (Yu and Xiong, 2025) is a rewriter built by fine-tuning Qwen3-4B with reinforcement learning, which faithfully recycles web data. ReWire (Nguyen et al., 2025) uses a prompt-based approach that asks an LLM to expand the key points of the text during rewriting. To compare these methods fairly, we use Qwen3-4B (non-thinking) as the rewriting LLM for ReWire as well, which is the same model that DataOrchestra uses in its rewriting stages.

6

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

Data Curation and Pretraining We use RedPajama-V2 (Weber et al., 2024), a large-scale web corpus built from Common Crawl that spans multiple quality buckets. We randomly sample 40B tokens and process them with each baseline method. Note that RePro and ReWire, in their original papers, select data with a fastText classifier and mix the rewritten data with the raw data, and we leave the comparison under this mixing setup to Section 4.4. In this section, for a fair comparison with the other baselines, we do not apply such mixing and instead train directly on the rewritten data. We pretrain Transformer models from scratch at three sizes, 0.5B, 1.5B, and 7B. For all methods at 0.5B and 1.5B, we set the training budget at 20B tokens, and for 7B we train on 30B tokens. Details of the model configurations and hyper-parameters are given in Appendix B. Evaluation We evaluate on 11 widely used benchmarks: ARC-Easy and ARC-Challenge (Clark et al., 2018), MMLU (Hendrycks et al., 2020), HellaSwag (Zellers et al., 2019), WinoGrande (Sakaguchi et al., 2021), PIQA (Bisk et al., 2020), CommonsenseQA (Talmor et al., 2019), SIQA (Sap et al., 2019), RACE (Lai et al., 2017), OpenBookQA (Mihaylov et al., 2018), and SciQ (Welbl et al., 2017). Details of evaluation are given in Appendix D. We report accuracy on each benchmark and the average across all of them. To reduce the variance of the reported numbers, for every benchmark and for the average we report the mean over the three most recently saved checkpoints (saved about every 2B tokens). 4.2. Main Results Table 2 reports downstream performance for models pretrained from scratch at 0.5B, 1.5B, and 7B parameters. DataOrchestra achieves the best average score at all scales, outperforming the strongest baseline respectively, with its advantage growing with model size. Among the baselines, ProX is already competitive, showing that lightweight line-level noise removal improves data quality, whereas RePro and ReWire perform poorly when trained only on rewritten data. This does not mean full rewriting is ineffective: on knowledge benchmarks such as ARC and MMLU, RePro and ReWire improve in most cases, ReWire more so, suggesting that rewriting can make knowledge more explicit. However, they often underperform on language understanding benchmarks such as HellaSwag, RACE, OpenBookQA, and PIQA, likely because training only on synthetic text reduces the linguistic diversity and natural discourse of web data, and rewriting into structured formats can break reasoning steps that are naturally connected in the original prose. RePro and ReWire mix rewritten and original data in their original settings; we study this in Section 4.4. 4.3. Generalization across Datasets and Settings Additional Web Datasets Besides RedPajama-V2, we apply DataOrchestra to three other widely used web corpora: DCLM-RefinedWeb (Li et al., 2024), C4 (Raffel et al., 2020), and FineWeb (Penedo et al., 2024). We follow the same setup as in Section 4.1 and pretrain models from scratch at 0.5B on the curated data. The left panel of Figure 3 reports the results. Across all three datasets, DataOrchestra gives consistent average gains over the baselines, which shows that its benefit does not depend on any particular web corpus. Math Continued Pretraining We also study whether DataOrchestra helps on domain data, taking math as a representative domain. We build on Davinci-Origin-3B (Qin et al., 2026), a fully transparent checkpoint pretrained on 1T tokens and never trained on science QA data, which makes it a clean base for continued-pretraining experiments in the science domain. We apply all methods to two math corpora, OpenWebMath (Paster et al., 2024) and MegaMath (Zhou et al., 2025). Since continued pretraining on a single domain can cause catastrophic forgetting (Luo et al., 2025), we 7

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

Table 2 | Downstream performance of models pretrained from scratch at 0.5B, 1.5B, and 7B on RedPajama-V2 data curated by different methods. The best result in each column within a panel is in bold, and the second best is underlined.

Method

ARC-E

ARC-C

MMLU

HellaS.

RACE

WinoG.

OBQA

PIQA

CSQA

SIQA

SciQ

AVG

49.01 52.49 52.67 52.80 51.83 51.88

25.87 28.20 26.87 25.07 26.13 29.20

65.67 67.34 67.03 64.67 63.86 66.50

19.63 19.57 19.55 20.48 20.17 20.56

37.50 38.69 38.55 37.09 37.29 38.40

63.13 61.97 64.47 62.10 64.60 66.90

37.63 38.83 39.09 37.81 38.26 39.99

50.70 52.38 51.46 51.70 51.99 53.62

28.53 30.13 30.53 26.27 27.47 31.40

68.44 69.73 69.13 67.32 66.14 69.08

19.08 19.63 19.82 20.47 20.01 19.93

38.84 39.61 38.95 37.26 36.98 39.08

67.90 64.50 67.80 65.87 67.77 72.63

39.87 40.71 41.08 39.38 40.03 42.44

54.41 56.46 54.12 53.80 55.80 57.43

31.67 34.20 33.13 31.87 33.20 35.07

72.34 73.34 73.61 70.77 69.33 73.74

21.76 19.46 19.90 20.34 21.16 19.98

40.92 40.74 41.66 39.76 39.90 42.72

77.30 73.23 77.80 72.57 79.60 79.73

44.79 45.41 45.74 43.27 45.00 47.66

0.5B Raw Rule-based ProX RePro ReWire DataOrchestra

39.39 40.97 42.42 39.51 42.85 44.75

23.72 25.31 25.11 24.54 26.68 27.16

26.67 26.55 27.01 27.13 27.48 27.60

34.99 36.84 37.04 34.89 34.32 36.80

28.36 29.25 29.31 27.69 25.61 30.18 1.5B

Raw Rule-based ProX RePro ReWire DataOrchestra

43.13 43.73 46.09 43.01 45.59 49.92

25.17 25.28 25.17 26.00 28.50 27.50

27.41 27.76 28.13 27.43 28.42 28.86

40.54 44.17 43.46 38.54 38.16 43.04

28.87 30.88 31.39 29.35 29.25 31.77 7B

Raw Rule-based ProX RePro ReWire DataOrchestra

51.50 52.41 53.72 49.30 54.12 58.71

27.84 29.35 29.27 27.45 32.08 33.96

29.67 30.35 30.56 30.72 31.63 32.22

52.62 56.23 55.72 47.35 46.28 55.95

32.70 33.72 33.62 32.09 31.93 34.77

mix the curated math data with general-domain data for every method (details in Appendix C). The training budget is 10B tokens for OpenWebMath and 15B for MegaMath, both including the mixed-in data, and we evaluate on 9 science reasoning benchmarks (Appendix D). As shown in the right panel of Figure 3, DataOrchestra achieves the best average performance, confirming that it also improves data quality for domain continued pretraining. Full per-benchmark results for this section are in Appendix H. 4.4. Comparison with Mixtures of Rewritten and Raw Data In the main results (Section 4.2), RePro and ReWire perform poorly when trained only on rewritten data. Since training purely on synthetic data can cause model collapse and a loss of textual diversity, we now study mixing the rewritten data back with raw text. For each of the three rewriting methods (RePro, ReWire, and DataOrchestra), we mix 10B tokens of rewritten data with 10B tokens of raw data, keeping the total budget (20B tokens) unchanged. We try two strategies: random mixing and fastText mixing which keeps the highest-scoring 10B tokens on each side using the DCLM fastText classifier (Li et al., 2024). All models are pretrained from scratch at 0.5B following Section 4.1. Figure 4 reports the results. Mixing helps, but depends on the quality of the raw data mixed in. FastText selection lifts both RePro and ReWire above Raw and ProX, whereas random selection is less reliable: it may mix in the low-quality part of the raw data, leaving the result near or even below Raw (e.g., ReWire). DataOrchestra behaves differently: even without mixing, it already reaches the best score and surpasses every mixing configuration of the two baselines. We attribute this to the orchestrator, which naturally keeps high-quality raw chunks untouched and mixes them with the rewritten ones. Moreover, FastText mixing gives a further gain for DataOrchestra. Full 8

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

Avg Performance

10

15

40 39 38 37 36 35 20

C4

40 39 38 37 36 35 10

15

20

10

20

FineWeb

40 39 38 37 36 35 34

Training tokens (B) Raw Rule-based

15

10

15

Training tokens (B) ProX RePro

20

Avg Science Performance

40 39 38 37 36 35

Math Datasets

DCLM-RefinedWeb

OpenWebMath

17.0 16.5 16.0 15.5 15.0

Avg Science Performance

Avg Performance

Web Datasets

RedPajama-V2

ReWire

2

4

6

8

10

MegaMath 17 16 15 5

10

Training tokens (B) DataOrchestra

15

Figure 3 | Average performance for methods including four web datasets and two math datasets. per-benchmark results are in Appendix I. 4.5. Comparison with Multi-stage Pipelines In practice, data curation often combines several operations into a multi-stage pipeline. We therefore compare DataOrchestra with such pipelines on both performance and efficiency, following Section 4.1. Starting from Drop, we progressively add NP, SR, and PA, and also include an end-toend variant that replaces the three stages with a single full rewrite (prompt in Appendix E). For every pipeline involving rewriting, we additionally train a version that mixes in fastText-selected raw data, as in Section 4.4. All pipelines use the same tool models and prompts for NP, SR, and PA as DataOrchestra. We also estimate the compute spent on data curation, measured by the FLOPs of LLM inference (details in Appendix G). Results are shown in Table 3. Overall, performance improves steadily as more stages are added on top of fastText mixing. The end-to-end rewrite works reasonably well, yet still trails the full multi-stage pipeline. Among all methods, DataOrchestra achieves the best result even without mixing, and mixing brings a further gain. It is also efficient, spending less compute than both the full NP/SR/PA pipeline and the end-to-end rewrite: although the orchestrator adds some cost, it routes each chunk to only the operations it needs, keeping the whole pipeline cost-effective.

5. Analysis and Ablations 5.1. Analysis of Orchestrator Decisions Decisions and Data Quality We score every chunk with DataMan (Peng et al., 2025) and relate the scores to the decisions made by the orchestrator (Figure 5a). Drop is applied to the lowest-scoring chunks. Among the cleaning operations, SR has the lowest source quality, since it handles chunks whose noise cannot be fixed by the lighter NP, while PA has the highest, since it targets knowledge-rich 9

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

Average Performance

40.5

No Mixture Raw

Random Mixture ProX

Drop

FastText Mixture

AVG ↑

EFLOPs ↓

Raw

37.63

0

✓ ✓ ✓ ✓ ✓ ✓

✓ ✓ ✓ ✓ ✓

✓ ✓

38.88 39.09 38.22 39.25 39.59 39.83

52 97 572 572 1236 1236

✓ ✓

End-to-End End-to-End

38.58 39.67

824 824

DataOrchestra DataOrchestra

39.99 40.13

782 782

40.0 39.5 39.0 38.5 38.0 37.5 RePro

ReWire

DataOrchestra

NP

SR

✓ ✓ ✓ ✓

PA

Mix

Figure 4 | Effect of mixing rewritten data with raw Table 3 | Comparison with multi-stage datadata for methods that involve LLM rewriting. processing pipelines.

text. These trends show that the orchestrator routes each chunk in a sensible way. We also find that about 35% of the chunks are directly dropped or left untouched in the first step, and not every cleaning chunk goes through rewriting operations, which confirms that DataOrchestra saves compute by skipping unnecessary operations. Token Count Changes by Operation Figure 5b shows the token counts before and after each operation. NP reduces tokens the most, as it removes whole lines from chunks with the most obvious surface noise. SR reduces tokens less, since it mainly repairs rather than deletes. PA instead increases tokens substantially, because it expands knowledge-rich text with additional knowledge points and reasoning steps. These changes match the design goal of each operation. 5.2. Ablation Study of Plan Evolution and Rewriting Instruction

Performance

Proportion (%)

To verify that the procedures for training the No content loss No factual error AVG orchestrator are effective, we conduct two abla100 96.7 40.0 96.4 96.2 tions. DataOrchestra w/o evolution removes 89.6 the fine-grained plan evolution, training the or81.6 80.9 39.5 80.8 80 76.2 chestrator directly on the coarse-grained plans and thus generating no chunk-specific instruc39.0 tion. DataOrchestra w/o instruction keeps 60 the evolution but drops the instruction at infer38.5 45.4 ence time. To further assess rewriting quality, 40 38.0 33.8 we sample 700K documents and use a teacher LLM to compare each chunk before and after 37.5 20 rewriting, judging whether information is lost RePro ReWire w/o evo w/o inst DataOrchestra or factual errors are introduced (the evaluation prompt is given in Appendix F). Figure 6 re- Figure 6 | Ablation of plan evolution and rewriting ports the results, with RePro and ReWire for instruction. comparison. First, both the plan evolution and the chunk-specific instruction improve performance, as removing either lowers the average score. Second, all three DataOrchestra variants preserve information and avoid factual errors far better

10

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

2

Drop

25.1

4

5

2.49

3.77

NP

3.48

SR PA

20 30 40 50 Proportion (%) Score

55.0

SR

Avg: 637 toks Avg: 540 toks

PA

Avg: 670 toks Avg: 1,594 toks

57.8 4.14

27.0

10

Avg: 576 toks Avg: 387 toks

3.78

10.8

0

After Operation

NP

Density

Untouch

3

Density

1

Before Operation

Proportion (%)

(a) Quality and distribution of each decision.

60

Density

0

Score

101

102 103 Number of tokens

104

(b) Token distribution before/after each operation.

Figure 5 | Analysis of the orchestrator’s decisions. (a) For each operation, the average DataMan quality score of the source chunks it is applied to, and the proportion of all chunks that receive it. (b) The token-count distribution of chunks before and after NP, SR, and PA. than the baselines. RePro is relatively safe, being trained with reinforcement learning toward faithful rewriting, whereas ReWire, encouraged to expand text freely, loses information and adds incorrect knowledge more often. Interestingly, this free expansion also gives ReWire an apparent edge on some knowledge benchmarks despite being less faithful.

6. Conclusion In this paper, we present DataOrchestra, a framework that orchestrates a per-example data curation pipeline for LLM pretraining. A small orchestrator model decides, for each chunk of data, whether to drop, keep, or clean it, and further selects which cleaning stages to apply and generates a chunk-specific instruction for each rewriting step. Experiments show that DataOrchestra consistently outperforms both individual data-processing methods and fixed multi-stage pipelines, while saving compute by skipping unnecessary operations.

References A. Abbas, K. Tirumala, D. Simig, S. Ganguli, and A. S. Morcos. Semdedup: Data-efficient learning at web-scale through semantic deduplication. arXiv preprint arXiv:2303.09540, 2023. L. Ben Allal, A. Lozhkov, G. Penedo, T. Wolf, and L. von Werra. Cosmopedia, 2024. URL https: //huggingface.co/datasets/HuggingFaceTB/cosmopedia. B. Bi, S. Liu, X. Ren, D. Liu, J. Lin, Y. Wang, L. Mei, J. Fang, J. Guo, and X. Cheng. Refinex: Learning to refine pre-training data at scale from expert-guided programs. arXiv preprint arXiv:2507.03253, 2025.

11

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

Y. Bisk, R. Zellers, J. Gao, Y. Choi, et al. Piqa: Reasoning about physical commonsense in natural language. In Proceedings of the AAAI conference on artificial intelligence, volume 34, pages 7432–7439, 2020. P. Clark, I. Cowhey, O. Etzioni, T. Khot, A. Sabharwal, C. Schoenick, and O. Tafjord. Think you have solved question answering? try arc, the ai2 reasoning challenge. arXiv preprint arXiv:1803.05457, 2018. K. Cobbe, V. Kosaraju, M. Bavarian, M. Chen, H. Jun, L. Kaiser, M. Plappert, J. Tworek, J. Hilton, R. Nakano, et al. Training verifiers to solve math word problems. arXiv preprint arXiv:2110.14168, 2021. X. Du, Y. Yao, K. Ma, B. Wang, T. Zheng, M. Liu, Y. Liang, X. Jin, Z. Wei, C. Zheng, et al. Supergpqa: Scaling llm evaluation across 285 graduate disciplines. Advances in Neural Information Processing Systems, 38, 2026. L. Engstrom, A. Feldmann, and A. Madry. Dsdm: Model-aware dataset selection with datamodels. arXiv preprint arXiv:2401.12926, 2024. K. Fujii, Y. Tajima, S. Mizuki, M. Kawamura, H. Shimada, T. Shiotani, K. Saito, M. Oi, T. Nakamura, T. Okamoto, et al. Rewriting pre-training data boosts llm performance in math and code. arXiv preprint arXiv:2505.02881, 2025. L. Gao, J. Tow, B. Abbasi, S. Biderman, S. Black, A. DiPofi, C. Foster, L. Golding, J. Hsu, A. Le Noac’h, H. Li, K. McDonell, N. Muennighoff, C. Ociepa, J. Phang, L. Reynolds, H. Schoelkopf, A. Skowron, L. Sutawika, E. Tang, A. Thite, B. Wang, K. Wang, and A. Zou. The language model evaluation harness, 07 2024. URL https://zenodo.org/records/12608602. M. Gerstgrasser, R. Schaeffer, A. Dey, R. Rafailov, H. Sleight, J. Hughes, T. Korbak, R. Agrawal, D. Pai, A. Gromov, et al. Is model collapse inevitable? breaking the curse of recursion by accumulating real and synthetic data. arXiv preprint arXiv:2404.01413, 2024. S. Gunasekar, Y. Zhang, J. Aneja, C. C. T. Mendes, A. Del Giorno, S. Gopi, M. Javaheripi, P. Kauffmann, G. de Rosa, O. Saarikivi, et al. Textbooks are all you need. arXiv preprint arXiv:2306.11644, 2023. X. Hao, R. Zhu, G. Zhang, K. Shen, and C. Li. Reformulation for pretraining data augmentation. arXiv preprint arXiv:2502.04235, 2025. D. Hendrycks, C. Burns, S. Basart, A. Zou, M. Mazeika, D. Song, and J. Steinhardt. Measuring massive multitask language understanding. arXiv preprint arXiv:2009.03300, 2020. D. Hendrycks, C. Burns, S. Kadavath, A. Arora, S. Basart, E. Tang, D. Song, and J. Steinhardt. Measuring mathematical problem solving with the math dataset. arXiv preprint arXiv:2103.03874, 2021. L. Huang, W. Yu, W. Ma, W. Zhong, Z. Feng, H. Wang, Q. Chen, W. Peng, X. Feng, B. Qin, et al. A survey on hallucination in large language models: Principles, taxonomy, challenges, and open questions. ACM Transactions on Information Systems, 43(2):1–55, 2025. A. Joulin, E. Grave, P. Bojanowski, and T. Mikolov. Bag of tricks for efficient text classification. In Proceedings of the 15th conference of the European chapter of the association for computational linguistics: volume 2, short papers, pages 427–431, 2017. J. Kaplan, S. McCandlish, T. Henighan, T. B. Brown, B. Chess, R. Child, S. Gray, A. Radford, J. Wu, and D. Amodei. Scaling laws for neural language models. arXiv preprint arXiv:2001.08361, 2020.

12

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

G. Lai, Q. Xie, H. Liu, Y. Yang, and E. Hovy. Race: Large-scale reading comprehension dataset from examinations. In Proceedings of the 2017 conference on empirical methods in natural language processing, pages 785–794, 2017. K. Lee, D. Ippolito, A. Nystrom, C. Zhang, D. Eck, C. Callison-Burch, and N. Carlini. Deduplicating training data makes language models better. In Proceedings of the 60th Annual Meeting of the Association for Computational Linguistics (Volume 1: Long Papers), pages 8424–8445, 2022. J. Li, A. Fang, G. Smyrnis, M. Ivgi, M. Jordan, S. Gadre, H. Bansal, E. Guha, S. Keh, K. Arora, et al. Datacomp-lm: In search of the next generation of training sets for language models. Advances in Neural Information Processing Systems, 37:14200–14282, 2024. H. Lightman, V. Kosaraju, Y. Burda, H. Edwards, B. Baker, T. Lee, J. Leike, J. Schulman, I. Sutskever, and K. Cobbe. Let’s verify step by step. In International Conference on Learning Representations, volume 2024, pages 39578–39601, 2024. R. Liu, J. Wei, F. Liu, C. Si, Y. Zhang, J. Rao, S. Zheng, D. Peng, D. Yang, D. Zhou, et al. Best practices and lessons learned on synthetic data. arXiv preprint arXiv:2404.07503, 2024. Y. Luo, Z. Yang, F. Meng, Y. Li, J. Zhou, and Y. Zhang. An empirical study of catastrophic forgetting in large language models during continual fine-tuning. IEEE Transactions on Audio, Speech and Language Processing, 2025. P. Maini, S. Seto, R. Bai, D. Grangier, Y. Zhang, and N. Jaitly. Rephrasing the web: A recipe for compute and data-efficient language modeling. In Proceedings of the 62nd Annual Meeting of the Association for Computational Linguistics (Volume 1: Long Papers), pages 14044–14072, 2024. P. Maini, V. Dorna, P. Doshi, A. Carranza, F. Pan, J. Urbanek, P. Burstein, A. Fang, A. Deng, A. Abbas, et al. Beyondweb: Lessons from scaling synthetic data for trillion-scale pretraining. arXiv preprint arXiv:2508.10975, 2025. T. Mi, D. Shan, Z. Huang, Y. Qin, M. Xie, Y. Qiao, Y. Liu, C. Zhou, and P. Liu. Data darwinism part ii: Dataevolve–ai can autonomously evolve pretraining data curation. arXiv preprint arXiv:2603.14420, 2026. T. Mihaylov, P. Clark, T. Khot, and A. Sabharwal. Can a suit of armor conduct electricity? a new dataset for open book question answering. In Proceedings of the 2018 conference on empirical methods in natural language processing, pages 2381–2391, 2018. C. Mohri, J. Duchi, and T. Hashimoto. A bitter lesson for data filtering. arXiv preprint arXiv:2605.19407, 2026. T. Nguyen, Y. Li, O. Golovneva, L. Zettlemoyer, S. Oh, L. Schmidt, and X. Li. Recycling the web: A method to enhance pre-training data quality and quantity for language models. arXiv preprint arXiv:2506.04689, 2025. J. Niklaus, A. Yamaguchi, M. Štefánik, G. Penedo, H. Kydlíček, E. Bakouch, L. Tunstall, E. E. Beeching, T. Frere, C. Raffel, et al. How can we synthesize high-quality pretraining data? a systematic study of prompt design, generator model, and source data. arXiv preprint arXiv:2604.13977, 2026. K. Paster, M. Dos Santos, Z. Azerbayev, and J. Ba. Openwebmath: An open dataset of high-quality mathematical web text. In International Conference on Learning Representations, volume 2024, pages 20357–20379, 2024.

13

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

G. Penedo, Q. Malartic, D. Hesslow, R. Cojocaru, A. Cappelli, H. Alobeidli, B. Pannier, E. Almazrouei, and J. Launay. The refinedweb dataset for falcon llm: outperforming curated corpora with web data, and web data only. arXiv preprint arXiv:2306.01116, 2023. G. Penedo, H. Kydlíček, A. Lozhkov, M. Mitchell, C. Raffel, L. Von Werra, T. Wolf, et al. The fineweb datasets: Decanting the web for the finest text data at scale. Advances in Neural Information Processing Systems, 37:30811–30849, 2024. R. Peng, K. Yang, Y. Zeng, J. Lin, D. Liu, and J. Zhao. Dataman: Data manager for pre-training large language models. arXiv preprint arXiv:2502.19363, 2025. Y. Qin, Z. Huang, T. Mi, W. Si, C. Zhou, Q. Guo, S. Feng, and P. Liu. Data darwinism part i: Unlocking the value of scientific data for pre-training. arXiv preprint arXiv:2602.07824, 2026. J. W. Rae, S. Borgeaud, T. Cai, K. Millican, J. Hoffmann, F. Song, J. Aslanides, S. Henderson, R. Ring, S. Young, et al. Scaling language models: Methods, analysis & insights from training gopher. arXiv preprint arXiv:2112.11446, 2021. C. Raffel, N. Shazeer, A. Roberts, K. Lee, S. Narang, M. Matena, Y. Zhou, W. Li, and P. J. Liu. Exploring the limits of transfer learning with a unified text-to-text transformer. Journal of machine learning research, 21(140):1–67, 2020. D. Rein, B. L. Hou, A. C. Stickland, J. Petty, R. Y. Pang, J. Dirani, J. Michael, and S. R. Bowman. Gpqa: A graduate-level google-proof q&a benchmark. arXiv preprint arXiv:2311.12022, 2023. K. Sakaguchi, R. L. Bras, C. Bhagavatula, and Y. Choi. Winogrande: An adversarial winograd schema challenge at scale. Communications of the ACM, 64(9):99–106, 2021. M. Sap, H. Rashkin, D. Chen, R. Le Bras, and Y. Choi. Social iqa: Commonsense reasoning about social interactions. In Proceedings of the 2019 conference on empirical methods in natural language processing and the 9th international joint conference on natural language processing (EMNLP-IJCNLP), pages 4463–4473, 2019. M. Shoeybi, M. Patwary, R. Puri, P. LeGresley, J. Casper, and B. Catanzaro. Megatron-lm: Training multi-billion parameter language models using model parallelism. arXiv preprint arXiv:1909.08053, 2019. D. Su, K. Kong, Y. Lin, J. Jennings, B. Norick, M. Kliegl, M. Patwary, M. Shoeybi, and B. Catanzaro. Nemotron-cc: Transforming common crawl into a refined long-horizon pretraining dataset. In Proceedings of the 63rd Annual Meeting of the Association for Computational Linguistics (Volume 1: Long Papers), pages 2459–2475, 2025. A. Talmor, J. Herzig, N. Lourie, and J. Berant. Commonsenseqa: A question answering challenge targeting commonsense knowledge. In Proceedings of the 2019 Conference of the North American Chapter of the Association for Computational Linguistics: Human Language Technologies, Volume 1 (Long and Short Papers), pages 4149–4158, 2019. K. Team, Y. Bai, Y. Bao, Y. Charles, C. Chen, G. Chen, H. Chen, H. Chen, J. Chen, N. Chen, et al. Kimi k2: Open agentic intelligence. arXiv preprint arXiv:2507.20534, 2025. Q. Team. Qwen2.5: A party of foundation models, September 2024. URL https://qwenlm.githu b.io/blog/qwen2.5/.

14

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

X. Wang, Z. Hu, P. Lu, Y. Zhu, J. Zhang, S. Subramaniam, A. R. Loomba, S. Zhang, Y. Sun, and W. Wang. Scibench: Evaluating college-level scientific problem-solving abilities of large language models. arXiv preprint arXiv:2307.10635, 2023. Y. Wang, X. Ma, G. Zhang, Y. Ni, A. Chandra, S. Guo, W. Ren, A. Arulraj, X. He, Z. Jiang, T. Li, M. Ku, K. Wang, A. Zhuang, R. Fan, X. Yue, and W. Chen. Mmlu-pro: A more robust and challenging multi-task language understanding benchmark, 2024. M. Weber, D. Y. Fu, Q. Anthony, Y. Oren, S. Adams, A. Alexandrov, X. Lyu, H. Nguyen, X. Yao, V. Adams, et al. Redpajama: an open dataset for training large language models. Advances in neural information processing systems, 37:116462–116492, 2024. J. Welbl, N. F. Liu, and M. Gardner. Crowdsourcing multiple choice science questions. In Proceedings of the 3rd Workshop on Noisy User-generated Text, pages 94–106, 2017. G. Wenzek, M.-A. Lachaux, A. Conneau, V. Chaudhary, F. Guzmán, A. Joulin, and E. Grave. Ccnet: Extracting high quality monolingual datasets from web crawl data. In Proceedings of the twelfth language resources and evaluation conference, pages 4003–4012, 2020. A. Wettig, A. Gupta, S. Malik, and D. Chen. Qurating: Selecting high-quality data for training language models. arXiv preprint arXiv:2402.09739, 2024. Z. Yang, N. Band, S. Li, E. Candes, and T. Hashimoto. Synthetic continued pretraining. arXiv preprint arXiv:2409.07431, 2024. Z. Yu and C. Xiong. Repro: Training language models to faithfully recycle the web for pretraining. arXiv preprint arXiv:2510.10681, 2025. Z. Yu, S. Das, and C. Xiong. Mates: Model-aware data selection for efficient pretraining with data influence models. Advances in Neural Information Processing Systems, 37:108735–108759, 2024. R. Zellers, A. Holtzman, Y. Bisk, A. Farhadi, and Y. Choi. Hellaswag: Can a machine really finish your sentence? In Proceedings of the 57th annual meeting of the association for computational linguistics, pages 4791–4800, 2019. F. Zhou, Z. Wang, Q. Liu, J. Li, and P. Liu. Programming every example: Lifting pre-training data quality like experts at scale. arXiv preprint arXiv:2409.17115, 2024. F. Zhou, Z. Wang, N. Ranjan, Z. Cheng, L. Tang, G. He, Z. Liu, and E. P. Xing. Megamath: Pushing the limits of open math corpora. arXiv preprint arXiv:2504.02807, 2025.

15

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

Appendix A. Details of Orchestrator Model Training A.1. Details of Data Collection Our seed pool is drawn from six widely used public pretraining corpora, covering a general domain and a science domain. The acquisition protocol for each source is detailed below. General Domain • RedPajama-V2 A large multilingual CommonCrawl derivative hosted by Together. We restrict the selection to the English partition and apply explicit random subsampling: from the full set of English document groups—each identified by a snapshot/partition key such as 2014-15/0000— we draw a uniform random sample of 1,000 groups. For every sampled group we retrieve all three quality buckets (head, middle, tail) so that the resulting pool spans the full quality spectrum rather than being biased toward any single bucket. • DCLM-RefinedWeb A CommonCrawl-derived corpus released through the DataComp effort. We retrieve a single global shard, global-shard_03_of_10, from the public S3 prefix s3: //commoncrawl/contrib/datacomp/DCLM-refinedweb/, transferring all ten of its constituent local shards with the high-throughput s5cmd client. No subsampling is applied within the global shard. • C4 The Colossal Clean Crawled Corpus, in its English configuration from the HuggingFace Hub. We use the full set of obtained shards without further subsampling. • FineWeb A deduplicated, quality-filtered CommonCrawl corpus from the HuggingFace Hub. We use the full set of obtained shards without further subsampling. Science Domain • OpenWebMath A mathematics-focused corpus built from CommonCrawl HTML. Its construction filters documents to retain those that are English, mathematically substantive, and of high quality, with particular care taken to faithfully extract LaTeX expressions and to suppress boilerplate relative to generic web corpora. We download the full dataset from the HuggingFace Hub. • MegaMath A large-scale, open mathematical pretraining corpus curated from diverse mathfocused sources, comprising re-extracted mathematical web documents, recalled math-related code, and synthetic data, for a total of 371B tokens. Among its constituent subsets, megamath-web is the web portion, re-extracted from CommonCrawl with math-oriented HTML processing followed by fastText-based filtering and deduplication. We download the complete megamath-web subset from the HuggingFace Hub. From each collected corpus we randomly sample 2.5B tokens for Orchestrator training, with the sole exception of OpenWebMath, from which we sample 0.5B tokens owing to its smaller total size. From the remaining documents of each corpus we then sample a further 40B tokens for the downstream pretraining experiments in Section 4; for OpenWebMath, whose remainder falls short of 40B, we instead take all of its documents not used for Orchestrator training. The two splits are disjoint, so that no document seen during Orchestrator training reappears in the pretraining experiments. After the DataMan-based scoring and low-quality upsampling described in Section 3.3, the Orchestrator

16

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

training split comprises 160K documents in total; its per-corpus document counts are reported in Table 4. Corpus

# Documents

RedPajama-V2 DCLM-RefinedWeb C4 FineWeb OpenWebMath MegaMath

30,000 30,000 30,000 30,000 20,000 20,000

Total

160,000

Table 4 | Per-corpus document counts in the Orchestrator training split.

A.2. Prompts for Coarse-grained Plan Generation The coarse-grained plan is produced in two steps. The first step decides whether to drop the chunk, using the quality-gate prompt shown in Figure 7. The second step routes each kept chunk through the three cleaning stages, making a binary True/False judgment on whether it needs noise pruning, surface rectification, and pedagogical augmentation, using the prompt shown in Figure 8. A.3. Details of Fine-grained Plan Evolution A.3.1. Prompts for Tool LLMs Each cleaning stage is executed by its own tool LLM. For noise pruning (NP), we follow ProX (Zhou et al., 2024) and fine-tune a small model dedicated to this stage. Since the behavior is learned during fine-tuning, NP does not need an elaborate prompt: as shown in Figure 9. For surface rectification (SR), our prompt is a lightly modified version of RePro (Yu and Xiong, 2025), shown in Figure 10. For pedagogical augmentation (PA), the prompt follows the same template as SR but targets pedagogical enrichment rather than surface repair, and is shown in Figure 11. A.3.2. Prompts for Verifier LLMs During fine-grained plan evolution, every executed stage is checked by a verifier LLM before it is committed to the plan, and we use two verifier prompts. The NP verifier, shown in Figure 12, receives the chunk before and after pruning, both line-numbered under the same scheme, and returns a keep/revert verdict; it reverts the NP step only when the deleted lines carry substantive content. The rewrite verifier, shown in Figure 13, is shared by SR and PA: it compares the before and after versions, scores the rewrite on a three-item rubric (no content loss, no factual error, no surface noise), and writes a chunk-specific instruction that drives the next rewriting attempt. To validate the reliability of these verifiers, we conduct a manual review of a sample of their verdicts and find over 83% agreement with human judgments. A.3.3. Fine-grained Plan Evolution Algorithm Algorithm 1 summarizes the fine-grained plan evolution described in Section 3.3 for a single chunk. We write 𝑔𝑠 for the general instruction shared by all chunks routed to a rewriting stage 𝑠, and 𝑝𝑠 for 17

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

System Prompt You are a pretraining data quality gate. Your task is to assess whether a document chunk contains value as language model pretraining data, assuming it will go through a multi-stage cleaning pipeline (noise pruning -> surface rectification -> pedagogical augmentation) after your assessment. Do NOT judge the chunk by its current surface quality -- a noisy chunk with valuable content underneath is still worth keeping. Instead, evaluate whether meaningful content can be recovered through reasonable cleaning effort. ## Important: The downstream cleaning pipeline can perform substantial format rectification -- removing boilerplate lines, stripping conversational filler, reformatting structure, etc. Your assessment should therefore focus primarily on the intellectual and linguistic VALUE of the underlying content, not on how much surface noise currently surrounds it. ## Document Format The chunk is wrapped in [DOC] / [/DOC] tags. Note: chunks are split by token limits, so the beginning and end may be mid-sentence or mid-paragraph. This is a normal chunking artifact -- do not penalise truncation at chunk boundaries. ## Scoring Rubric (additive 5-point) Points are accumulated based on the satisfaction of each criterion. Each criterion strictly requires all preceding criteria to be satisfied -- if a criterion is not met, no further points are awarded. - Add 1 point if substantive human-authored content exists. The chunk contains text that goes beyond minimal reactive expressions, navigational chrome, or structural boilerplate. The content must convey information, construct an argument, pose a substantive question, tell a narrative, or explain a concept. Short phatic utterances, user-generated micro-posts that carry no transferable linguistic signal, purely templated metadata (download links, file format listings, site navigation, SEO slugs, cookie/ad banners), and machine-generated or auto-populated listings do NOT satisfy this criterion. Pornographic, sexually explicit, fetishistic, or gratuitously violent content also does NOT satisfy this criterion regardless of length or coherence. - Add another point if the substantive content carries topical coherence around a subject that constitutes learnable knowledge or meaningful linguistic structure. The reader should be able to identify a discernible theme -- a topic being discussed, a question being investigated, a story being told -- not merely a collection of fragments that share a surface category. Coherence around purely structural or navigational purposes does not count. - Award a third point if the content, beneath any surface noise, is intellectually intact -- the ideas, reasoning, or narrative are not fundamentally broken. Fail this only if the core content itself is garbled, machine-generated gibberish masquerading as real text, or corrupted beyond semantic recovery. Surface-level noise of any kind does NOT cause failure here. - Grant a fourth point if the recoverable content carries genuine training value -- it provides factual information, coherent reasoning, narrative depth, technical explanation, well-posed questions with meaningful setup, or other linguistically rich material. Generic filler, SEO repetition, trivially templated text, and shallow listicles without original synthesis do NOT qualify. A well-articulated question carries value even without an answer. - Bestow a fifth point if the content exhibits high information density or domain value -- specialised knowledge, well-structured argumentation, educational depth, or rare high-quality material that would clearly enrich corpus diversity or quality.

User Prompt [DOC] {chunk} [/DOC] ## Output Format Respond in the following format without any other part. ``` ## Analysis <Briefly justify your total score. Focus on what content is recoverable and what makes it worth or not worth cleaning> ## Result <total points, an integer from 0 to 5> ```

Figure 7 | Prompt for the drop-decision quality gate in coarse-grained plan generation. the chunk-specific instruction that the procedure finally attaches to a retained stage; sim(·, ·) denotes the Levenshtein similarity between two chunks. Starting from the running chunk 𝑥 = 𝑐, the procedure processes the selected stages in pipeline order: it reverts NP when it over-prunes non-noise lines, and retries each rewriting stage under verifier-provided corrective instructions, dropping a stage that repeatedly fails or barely changes the chunk and otherwise annotating it with 𝑝𝑠 .

18

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

System Prompt You are a pretraining-data cleaning router. The document chunk you see has ALREADY passed an upstream drop gate -- it is worth keeping as pretraining data. Your job is to answer THREE yes/no sub-questions about which downstream tool models, if any, should run on this chunk. The chunk is wrapped in [DOC] / [/DOC] tags. Chunks are split by token limits, so the beginning and end may be mid-sentence or mid-paragraph -- this is a normal chunking artifact, not a defect. ## The three sub-questions ### (1) noise_pruning **Does this chunk contain any ENTIRE LINES of structural / boilerplate noise that can be removed cleanly by whole-line deletion?** `true` when one or more whole lines fall into any of these categories: - site UI / navigation / breadcrumbs / menu / sidebar / footer lines - social chrome, share buttons, comment-form scaffolding - reference / bibliography / citation blocks; book-card metadata (ISBN, page counts, standalone "Title: ..." / "Author: ..." / publication dates) - copyright / legal / cookie / disclaimer boilerplate; acknowledgments - page headers / footers, RSS-style page titles, feed markers - tracking tokens, ad chrome, download/login links separated as their own lines - other format-level noise that can be cleanly removed by whole-line deletion ... `false` when: - noise (if any) is inline INSIDE otherwise substantive lines -- line-level deletion would be too coarse - the chunk is already clean of whole-line noise ### (2) surface_rectification **Does the text carry disorganized FORMAT issues that requires REWRITING to fix?** `true` when one or more of these applies: - broken text flow from OCR / PDF / HTML extraction (mid-word hyphenation, sentences split across many short line) - structured content that has been shattered into short fragmented lines -- a table whose rows / columns are scattered across many isolated cells, an equation whose terms are split line by line, a code block whose statements are broken across single-character fragments, etc - mojibake / character-encoding artifacts / raw HTML entities mixed into prose - whitespace or indentation that has lost the original block / paragraph structure - any other format-level irregularities that need rephrasing to improve quality ... `false` when the remaining text reads cleanly as-is. ### (3) pedagogical_augmentation **Is this chunk knowledge-dense or reasoning-intensive?** This is a TEXT-TYPE classification. `true` for text types which contain rich knowledge or deep reasoning like: scientific / research papers, technical documentation, mathematical or algorithmic derivations, in-depth tutorials with non-trivial reasoning, textbook material, domain-expert analyses, code with non-trivial logic, etc. `false` for general-purpose text types like: news articles, casual blogs, narrative prose, forum discussions, product / business / restaurant listings, encyclopedic summaries, FAQ / customer-service text, recipes, schedules, lyrics, the long tail of general-purpose web text. Even if the writing is good, if the genre is general-purpose, the answer is `false`. ## Output format Respond with EXACTLY one JSON object and nothing else -- no preamble, no trailing commentary, no markdown headers outside the JSON. If you must use a code fence, use ```json ... ```. ```json { "noise_pruning": {"reasoning": "<1-2 sentences>", "value": true | false}, "surface_rectification": {"reasoning": "<1-2 sentences>", "value": true | false}, "pedagogical_augmentation": {"reasoning": "<1-2 sentences>", "value": true | false} } ``` Each `value` is exactly the boolean `true` or `false`. Each `reasoning` is 1-2 short sentences grounded in concrete observations about the chunk.

User Prompt ## Input [DOC] {chunk} [/DOC]

Figure 8 | Prompt for the cleaning-stage routing in coarse-grained plan generation. A.4. SFT Hyper-parameters We supervised fine-tune the Orchestrator from Qwen3-1.7B-Base on the roughly 300K (input, plan) pairs described in Section 3.3. Table 5 lists the hyper-parameters. We train for 3 epochs with a peak

19

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

System Prompt You are an excellent noise pruning model for pretraining data cleaning.

User Prompt [DOC] {chunk} [/DOC]

Figure 9 | Prompt for the noise pruning (NP) tool LLM. System Prompt You are a **surface rectification** specialist for pretraining data cleaning. Your job is to fix surface-level issues -- formatting damage, structural breakage, and disorganized text -- through careful rewriting. You must NOT alter the original meaning, introduce new information, or add any knowledge that is not already present in the text. This is a meaning-preserving rewrite, not a knowledge-adding one. ## Document Format Each given document chunk is wrapped in [DOC] / [/DOC] tags. Note: chunks are split by token limits, so the beginning and end may be mid-sentence or mid-paragraph. This is a normal chunking artifact -- do not attempt to complete or extend truncated text at chunk boundaries. ## Instructions Read the chunk thoroughly, then paraphrase it in high-quality and clear English following these rules: - Delete clearly irrelevant content: - Website headers, navigation bars, or menu items (e.g., "Home | About | Contact") - Unrelated HTTP links (e.g., ads, trackers, developer tools) - Generic footers (e.g., contact info, privacy policies, unsubscribe links) - Empty lines or decorative elements (e.g., "---") - Repair damaged structured content: - Repair damaged tables, diagrams, formulas, or code blocks that appear as consecutive lines of isolated words, single characters, or short fragments. Use surrounding context to reconstruct the intended structure. - Limited inference from surrounding context is permitted in this case. - Preserve all content that is relevant and meaningful: - Informative or independently useful - Related to the topic, even tangentially - Provides context, background, or supporting value - Includes technical terms, key concepts, factual details, reasoning, and examples - Handle mixed-relevance sentences carefully: - Remove only the irrelevant fragment if the rest remains coherent - Delete the whole sentence if the remainder loses meaning - Do not alter meaningful content unnecessarily: - Only delete or modify when content is clearly meaningless or off-topic - Preserve the original structure, logic, and depth of the text - Do not add explanations, notes, assumptions, or claims not found in the original text You may optionally consult the following expert rewriting suggestion. [HINT] {instruction} [/HINT]

User Prompt ## Input [DOC] {chunk} [/DOC] ## Output Format output ONLY the refined chunk as plain text (no introductory or concluding remarks, no [DOC]/[/DOC] or [HINT]/[/HINT] wrappers).

Figure 10 | Prompt for the surface rectification (SR) tool LLM. learning rate of 3×10−5 under a cosine schedule that decays to 10% of the peak, after a warmup over

20

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

System Prompt You are a **pedagogical augmentation** specialist for pretraining data cleaning. Your job is to enhance the pedagogical quality of document chunks by adding explanatory depth, clarifying reasoning, and lowering cognitive load for readers. ## Document Format Each given document chunk is wrapped in [DOC] / [/DOC] tags. Note: chunks are split by token limits, so the beginning and end may be mid-sentence or mid-paragraph. This is a normal chunking artifact -- do not attempt to complete or extend truncated text at chunk boundaries. ## What to Augment Augment the text by making implicit reasoning explicit (the goal, the strategy, and why it fits), demystifying jargon and notation with intuition-building analogies and examples before the formal explanation, illustrating abstract ideas with concrete cases, drawing contextual bridges to the broader field and foundational concepts, and anticipating learner confusion by addressing likely questions and flagging common misconceptions -- all woven naturally into the narrative like a mentor's margin notes. ALL data, formulas, definitions, theories, experimental results, and logical arguments must be preserved without altering their meaning. Your additions must clarify, never contradict. Do not directly generate an explanation based on the original text; it must be a self-consistent text that retains elements from the original text! You may optionally consult the following expert rewriting suggestion. [HINT] {instruction} [/HINT]

User Prompt ## Input [DOC] {chunk} [/DOC] ## Output Format output ONLY the fully augmented chunk as a self-contained educational text (plain text only, no introductory or concluding remarks, no [DOC]/[/DOC] or [HINT]/[/HINT] wrappers).

Figure 11 | Prompt for the pedagogical augmentation (PA) tool LLM. the first 3% of steps. We use a global batch size of 256 and a context length of 4096 tokens. A.5. Effect of Orchestrator Size We study how the size of the Orchestrator affects the quality of the curated data. We fine-tune three Orchestrators from Qwen3-0.6B-Base, Qwen3-1.7B-Base, and Qwen3-4B-Base on the same data, use each to curate the corpus, and pretrain a 0.5B model from scratch under the setup of Section 4.1. Table 6 reports the per-benchmark results. Performance improves clearly from the 0.6B to the 1.7B Orchestrator. However, scaling further to 4B does not help: its average performance is slightly below even the 0.6B model. Based on case study together with human review, we conjecture that the 4B Orchestrator tends to be more rigorous and conservative, and when generating rewriting instructions it often over-emphasizes preserving all of the original structure and information, which leads the downstream rewriting model to make more trivial edits. We therefore use the 1.7B Orchestrator by default, as it gives the best overall performance at a moderate cost. A.6. Sampling Parameters at Inference Table 7 lists the decoding parameters used for each model at inference time: the teacher LLM (Qwen3235B-A22B-Instruct, used for coarse-grained plan generation and verification), the Orchestrator, and the three tool models (NP, SR, PA). For the baseline methods, we instead follow the sampling parameters reported in their original papers. 21

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

System Prompt You are an **NP verifier** for pretraining-data cleaning. A noise-pruning specialist has deleted some lines from a document chunk. Your job is to decide whether those deletions removed any substantive content -- if so, the deletions must be reverted; otherwise they are kept. ## Input format You will receive two views of the same chunk, both line-numbered with the SAME numbering scheme so deletions are easy to locate: - **BEFORE NP** -- the chunk before pruning. Every line carries a [NNN] prefix. - **AFTER NP** -- the chunk after pruning. Lines that were removed have been replaced by a literal [NNN] <removed> marker so the line-number alignment with BEFORE is preserved. Both chunks are wrapped in [DOC] / [/DOC]. Chunks are token-bounded slices; mid-sentence ends at the chunk boundary are normal -- do not treat them as defects. ## What counts as substantive content A removed line is **substantive** if it carries factual content, definitions, named entities, code, equations, table data, narrative body, claims, or any other information a reader would actually learn from. Substantive content survives even when it sits next to surface noise. A removed line is **NOT substantive (i.e. legitimate noise)** if it is: - site UI / navigation / breadcrumbs / menus / footers / share buttons; - bibliographic or catalog metadata (ISBN, page counts, publication dates, standalone author/title lines, journal/citation chrome); - review/rating tuples without actual review text (e.g. "Amy B. - 2009 - 5 stars"); - page titles, RSS-style headers, feed markers, copyright/legal boilerplate; - FAQ / marketing / sign-offs ("P.S.", "<3 Stacy", "Stay tuned..."); - empty lines, decorative dividers ("---"), tracking tokens, ad chrome. ## Verdict rule - `keep` -- removed lines are legitimate noise (or trivially absent). The NP deletions stand. - `revert` -- removed lines carry substantive content. The whole NP step is reverted. Be calibrated, not preservationist. Before issuing `revert`, ask yourself honestly: do the deleted lines actually carry educational value for a language model -- would training on those lines genuinely make the model better at understanding language, knowledge, or reasoning? Most things noise-pruning typically removes (site chrome, catalog metadata, listings without prose, sign-offs, page titles) carry near-zero pretraining value even though they ARE original text from the chunk -- deleting them is the whole point of cleaning, not a defect. A small amount of "real" content being removed alongside obvious noise is NOT enough to revert; only choose `revert` when the deletions strip away genuinely important substantive content. When in doubt between "this removal is fine" and "this removal lost a tiny bit", lean `keep`. ## Output format Respond with EXACTLY one JSON object and nothing else. If you must use a code fence, use ```json ... ```. ```json { "reasoning": "<1-2 sentences>", "verdict": "keep" | "revert" } ```

User Prompt ## BEFORE NP [DOC] {before_chunk} [/DOC] ## AFTER NP [DOC] {after_chunk} [/DOC]

Figure 12 | Prompt for the noise pruning (NP) verifier LLM.

B. Details of From-Scratch Pretraining Models For the pretraining experiments in Section 4, we reuse the architectures of Qwen2.5-0.5B, Qwen2.5-1.5B, and Qwen2.5-7B (Team, 2024), but randomly initialize all parameters. All three are dense Transformer decoders that use RMSNorm, rotary position embeddings (RoPE), SwiGLU activations, and grouped-query attention. The 0.5B and 1.5B models tie their input and output embeddings, while the 7B model keeps them untied. Table 8 summarizes the per-size architecture.

22

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

System Prompt You are a **rewrite verifier and instruction author** for pretraining-data cleaning. A cleaning specialist has produced an AFTER version of a document chunk from its BEFORE version -- through format-fixing rewriting, or pedagogical augmentation that unpacks implicit reasoning / demystifies jargon / lowers cognitive load, or both. The specialist must not alter the meaning of the original material. You receive two versions of the SAME chunk and must (1) score the rewrite on a 3-item rubric AND (2) write a chunk-specific instruction that drives the next pass. ## Input format - **BEFORE** -- the chunk before the cleaning pass. - **AFTER** -- the chunk after the cleaning pass. Both BEFORE and AFTER are wrapped in [DOC] / [/DOC]. Chunks are token-bounded slices; mid-sentence ends at chunk boundaries are normal. ## Scoring rubric For each item write `reasoning` first (1-2 sentences), then `score` (the integer `0` or `1` -- `1` means "rubric item passes / no problem"). `no_content_loss` -- Every substantive piece of content in the BEFORE chunk survives in the AFTER chunk. "Substantive" covers facts, numerical values, named entities, definitions, examples, claims, reasoning steps, code, data, etc. Reformatting and interleaving entailed explanatory additions are fine. Removing genuine noisy information is fine and expected -- site navigation, ads, social-share UI, cookie banners, repeated headers/footers, copyright/legal boilerplate, etc. The failure modes to catch: (1) originally-present important information has been deleted, or replaced by a higher-level gloss/summary rather than preserved (e.g. exact numbers, formulas, terminology, quoted phrasing, or code dropped in favour of a paraphrase); (2) the AFTER chunk has been turned into commentary ABOUT the original -- an explanation, description, or meta-discussion of what the BEFORE text says -- rather than remaining a faithful presentation of the text itself, so that the original's own integrity as primary content is lost even if its points are mentioned. `no_factual_error` -- The rewrite introduced no factually incorrect or hallucinated information. Reconstructing damaged content from context, and inserting reasoning steps, intuitions, analogies, or jargon clarifications, are allowed -- but every such addition must be factually correct and entailed by the BEFORE text (or by uncontroversial domain knowledge naturally implied by it). `no_surface_noise` -- AFTER does not still carry obvious surface-level format noise (leftover headers/footers, timestamps, social chrome, cookie banners, breadcrumbs, tracking tokens, raw HTML scaffolding, OCR line breaks the specialist did not stitch up, mojibake, scattered single-character fragments from a damaged table/equation/code block, etc.). Also penalise meta-commentary artifacts introduced by the specialist itself -- preambles or postambles like "Here is the rephrased version:", "Below is the cleaned/enriched text:" -- if any appear, score 0. ## Instruction Always emit an `instruction` field: - **If ANY rubric item scored 0** -- the instruction tells the next attempt how to fix the specific problems you flagged. For example, emphasizing what needs to be fixed, what to keep, what to augment, or what not to expand (if you find that expanding a part easily causes hallucinations). - **If ALL three rubric items scored 1** -- write a detailed instruction that, read forward-looking from only BEFORE, would steer a future specialist to produce a result of the same quality. PS: - Your instruction MUST be grounded ONLY in what is visibly present in the BEFORE chunk. You may ONLY point at WHICH part needs WHICH kind of treatment -- you must NEVER supply the corrected text, the rewritten sentence, the reconstructed table contents, the unpacked reasoning, the definition, the analogy, the example, or the intended wording yourself. For example, "rejoin the OCR-split lines in the opening paragraph" is allowed; "the opening paragraph should read 'The system processes requests in three stages...'" is forbidden because it authors the fix / explanation instead of pointing at it. - Be concretely chunk-specific -- never generic guidance that could fit any chunk. Bad: "fix the formatting". Good: "rejoin the OCR-split lines in the beginning and rebuild the scattered three-column table near the end into aligned rows". Either way, the instruction must be a concrete, chunk-specific directive (usually 3-5 detailed points, at most 10 points, covering only the important issues -- do not mention trivial nits such as a single misspelling, a stray hyphen, or a missing space/comma, etc) -- never generic guidance that could fit any chunk. ## Output format Respond with EXACTLY one JSON object and nothing else. If you must use a code fence, use ```json ... ```. ```json { "no_content_loss": {"reasoning": "<sentences>", "score": 0 | 1}, "no_factual_error": {"reasoning": "<sentences>", "score": 0 | 1}, "no_surface_noise": {"reasoning": "<sentences>", "score": 0 | 1}, "instruction": "<clear chunk-specific instruction>" } ``` Each `score` is exactly the integer `0` or `1`. `instruction` must be a non-empty string. Do NOT add any extra keys.

User Prompt ## BEFORE [DOC] {before_chunk} [/DOC] ## AFTER [DOC] {after_chunk} [/DOC]

Figure 13 | Prompt for the rewrite verifier LLM, shared by the SR and PA stages.

23

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

Algorithm 1 Fine-grained Plan Evolution for one chunk Require: chunk 𝑐; selected cleaning stages S ⊆ {NP, SR, PA} in pipeline order; verifier 𝑉 ; tool models; max retries 𝑁 ; similarity threshold 𝜏 1: 𝑥 ← 𝑐 2: for each stage 𝑠 ∈ S in pipeline order do 3: if 𝑠 = NP then 4: 𝑥 ′ ← np( 𝑥 ) 5: if 𝑉 finds non-noise lines over-pruned in 𝑥 ′ then 6: drop NP from the plan ⊲ discard 𝑥 ′ , keep 𝑥 7: else 8: 𝑥 ← 𝑥′ 9: end if 10: else ⊲ 𝑠 ∈ {SR, PA}: a rewriting stage 11: instruction ← 𝑔𝑠 ; ok ← False 12: for 𝑡 ← 1 to 𝑁 do 13: 𝑥 ′ ← 𝑠 ( 𝑥, instruction) ⊲ rewrite under the current instruction 14: if 𝑉 confirms noise removed and fidelity preserved then 15: ok ← True; break 16: end if 17: 𝑝𝑠 ← corrective instruction from 𝑉 ; instruction ← 𝑔𝑠 ∥ 𝑝𝑠 18: end for 19: if ¬ ok or sim( 𝑥, 𝑥 ′ ) > 𝜏 then 20: drop 𝑠 from the plan ⊲ little or harmful change; discard 𝑥 ′ , keep 𝑥 21: else 22: if 𝑡 = 1 then ⊲ passed on the first attempt 23: 𝑝𝑠 ← instruction synthesized by 𝑉 from ( 𝑥, 𝑥 ′ ) 24: end if 25: annotate 𝑠 with 𝑝𝑠 ; 𝑥 ← 𝑥 ′ 26: end if 27: end if 28: end for

Training We pretrain all models with Megatron-LM (Shoeybi et al., 2019). Every run uses a sequence length of 2048 and a global batch size of 1024, i.e., about 2.1M tokens per step. We optimize with Adam ( 𝛽1 = 0.9, 𝛽2 = 0.95, 𝜖 = 10−8 ), a peak learning rate of 3 × 10−4 held constant after a linear warmup over the first 5% of steps, weight decay 0.1, and gradient clipping at 1.0, in bf16. We pack samples to the full sequence length and reset the attention mask and position ids at document boundaries, so tokens never attend across documents. The token budget is 20B for the 0.5B and 1.5B models and 30B for the 7B model, corresponding to about 9.5K and 14.3K steps. We save a checkpoint every 1000 steps, i.e., about every 2B tokens. The remaining hyper-parameters are shared across model sizes and listed in Table 9.

C. Data Mixture for Math Continued Pretraining For the math continued-pretraining experiments (Section 4), every method is trained on the same data mixture. The mixture consists of 50% target math data (the math corpus curated by that method), 35% general web data from DCLM-RefinedWeb (Li et al., 2024), and 15% from the synthetic QA subset of MegaMath (Zhou et al., 2025). The general web data mitigates catastrophic forgetting caused by domain shift, while the synthetic QA data strengthens the model’s ability to follow the question-answering format of the downstream generative science-reasoning benchmarks. We use the same ratios for all methods and for both corpora.

24

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

Hyper-parameter

Value

Base model Global batch size Learning rate Epochs LR scheduler Min LR ratio Warmup ratio Context length

Qwen3-1.7B-Base 256 3 × 10−5 3 cosine with min LR 0.1 0.03 4096

Table 5 | Hyper-parameters for supervised fine-tuning of the Orchestrator. Orchestrator

ARC-E

ARC-C

MMLU

HellaS.

RACE

WinoG.

OBQA

PIQA

CSQA

SIQA

SciQ

AVG

0.6B 1.7B 4B

45.55 44.75 44.64

26.17 27.16 26.39

27.74 27.60 27.55

36.99 36.80 36.21

29.63 30.18 29.51

52.14 51.88 51.64

28.20 29.20 29.73

65.92 66.50 66.50

20.39 20.56 19.85

38.33 38.40 37.89

64.07 66.90 63.70

39.56 39.99 39.42

Table 6 | Effect of the Orchestrator size on downstream performance (0.5B models pretrained from scratch). Each Orchestrator is fine-tuned from the corresponding Qwen3-Base model. The best result in each column is in bold and the second best is underlined.

D. Details of Evaluation We evaluate all models with our own framework, built on top of the LM-Evaluation-Harness (Gao et al., 2024). For the general benchmarks, we use likelihood-based (PPL) scoring, which ranks the candidate answers by likelihood instead of generating free-form text. We adopt this format because models pretrained from scratch still have weak instruction-following ability early in training. The math continued-pretraining experiments (Section 4) additionally use 9 science-reasoning benchmarks: GSM8K (Cobbe et al., 2021), MATH-500 (Hendrycks et al., 2021; Lightman et al., 2024), GPQA (Rein et al., 2023), SuperGPQA (Du et al., 2026), SciBench (Wang et al., 2023), the math and STEM splits of MMLU (Hendrycks et al., 2020) (MMLU-Math and MMLU-STEM), and the math and STEM splits of MMLU-Pro (Wang et al., 2024) (MMLU-Pro-Math and MMLU-Pro-STEM). These require free-form answers, so we instead evaluate them in the generative format with few-shot chainof-thought prompting and greedy decoding, and report exact-match accuracy. Table 10 summarizes the configuration of all benchmarks.

E. Prompt for the End-to-End Rewriting Baseline The end-to-end variant in Section 4.5 replaces the three NP/SR/PA stages with a single tool LLM that rewrites each chunk in one pass. Its prompt asks the model to triage the chunk and apply noise pruning, surface rectification, and pedagogical augmentation as needed, so that one call covers what DataOrchestra splits across three specialized stages. The full prompt is shown in Figure 14.

25

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

Teacher

Orchestrator

NP

SR

PA

0.7 0.8 20 0.0 1.5 1.0 False 8192

0.0 1.0 20 0.0 0.0 1.0 False 1024

0.0 1.0 20 0.0 0.0 1.0 False 1024

0.7 0.8 20 0.0 1.5 1.0 False 8192

0.7 0.8 20 0.0 1.5 1.0 False 8192

temperature top_p top_k min_p presence_penalty repetition_penalty enable_thinking max_tokens

Table 7 | Sampling parameters used at inference time for the teacher LLM, the Orchestrator, and the three tool models (NP, SR, PA). Configuration

0.5B

1.5B

7B

Layers Hidden size FFN hidden size Attention heads KV groups (GQA) Head dimension Vocabulary size Tied embeddings

24 896 4864 14 2 64 151,936 Yes

28 1536 8960 12 2 128 151,936 Yes

28 3584 18944 28 4 128 152,064 No

Table 8 | Architectures of the from-scratch pretrained models, following Qwen2.5. All models use RMSNorm (𝜖 = 10−6 ), RoPE (base 106 ), and SwiGLU.

F. Prompt for Rewriting-Quality Evaluation In the ablation of Section 5.2, we measure rewriting quality by sampling 700K documents and asking a teacher LLM (Qwen3-235B-A22B-Instruct-2507) to compare each chunk before and after rewriting. Unlike the rewrite verifier used during plan evolution (Figure 13), this evaluation only judges two properties of the rewrite, content preservation and factual correctness, and does not write any instruction. To validate the reliability of this evaluation, we conduct a manual review of a sample of the teacher LLM’s judgments and find over 86% agreement with human annotations. The prompt is shown in Figure 15.

G. Estimation of Data-Curation Compute To compare the cost of different curation pipelines, we estimate the compute each method spends on data cleaning, measured in floating-point operations (FLOPs). Data curation is an inference-time cost: every pipeline runs one or more LLMs over the raw corpus to produce the cleaned data used for pretraining, so we count the inference FLOPs of all LLM passes a method performs during curation. For a Transformer-based language model, the inference FLOPs of a single pass can be approximated as 2 𝑁 ( 𝐷in + 𝐷out ), where 𝑁 is the (non-embedding) parameter count and 𝐷in , 𝐷out are the numbers of input (prefill) and output (decode) tokens (Kaplan et al., 2020). Consider a pipeline of 𝐾 stages applied in sequence, where stage 𝑘 uses a model with 𝑁𝑘 non-embedding parameters, reads 𝐷in 𝑘 tokens, and writes 𝐷out tokens. The output of one stage becomes the input of the next. The total 𝑘 26

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

Hyper-parameter

Value

Sequence length Global batch size Optimizer Peak learning rate LR schedule Warmup ratio Weight decay Gradient clipping Precision Training tokens Checkpoint interval

2048 1024 Adam ( 𝛽1 =0.9, 𝛽2 =0.95, 𝜖=10−8 ) 3 × 10−4 constant (after warmup) 0.05 0.1 1.0 bf16 20B (0.5B, 1.5B) / 30B (7B) 1000 steps (≈ 2B tokens)

Table 9 | From-scratch pretraining hyper-parameters. curation compute is the sum of the per-stage costs: 𝐶curate ≈

𝐾 ∑︁

  out 2 𝑁𝑘 𝐷in + 𝐷 . 𝑘 𝑘

(1)

𝑘=1

This formulation covers all the methods we compare. For DataOrchestra we also include the orchestrator’s planning and per-chunk decision passes, since they are part of producing the cleaned data. Because curating a pretraining corpus involves processing tens of billions of tokens, the resulting FLOPs are very large. For readability, we report data-curation compute in exaFLOPs (EFLOPs), where the prefix “E” stands for exa, i.e., 1 EFLOP = 1018 FLOPs.

H. Full Results for Generalization across Datasets and Settings Here we report the per-benchmark scores behind Figure 3. As in the main results, each benchmark score is averaged over the last three checkpoints and AVG is the smoothed average; the best result in each column is in bold and the second best is underlined. Tables 11–13 cover the three additional web corpora (0.5B, from scratch). Tables 14–15 cover the two math corpora (3B continued pretraining), where the Base row is the model before continued pretraining; MMLU-M/MMLU-S denote the math/STEM splits of MMLU and MMLU-Pro-M/MMLU-Pro-S those of MMLU-Pro.

I. Full Results for Mixtures and Multi-stage Pipelines Tables 16 and 17 give the per-benchmark scores behind Section 4.4 (mixtures of rewritten and raw data) and Section 4.5 (multi-stage pipelines), respectively. Each benchmark score is averaged over the last three checkpoints and AVG is the smoothed average.

27

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

Benchmark

Abbr.

Type

Format

ARC-Easy ARC-Challenge MMLU HellaSwag RACE WinoGrande OpenBookQA PIQA CommonsenseQA SIQA SciQ

ARC-E ARC-C MMLU HellaS. RACE WinoG. OBQA PIQA CSQA SIQA SciQ

Knowledge Knowledge Knowledge Language Understanding Reading comprehension Language Understanding Commonsense reasoning Commonsense reasoning Commonsense reasoning Commonsense reasoning Reading comprehension

GSM8K MATH-500 GPQA SuperGPQA SciBench MMLU-Math MMLU-STEM MMLU-Pro-Math MMLU-Pro-STEM

GSM8K MATH GPQA SuperGPQA SciBench MMLU-M MMLU-S MMLU-Pro-M MMLU-Pro-S

Science reasoning Science reasoning Science reasoning Science reasoning Science reasoning Science reasoning Science reasoning Science reasoning Science reasoning

Shots # Examples

PPL PPL PPL PPL PPL PPL PPL PPL PPL PPL PPL

0 0 5 0 0 0 5 0 0 0 0

2,376 1,172 14,042 10,042 1,045 1,267 500 1,838 1,221 1,954 1,000

Generative Generative Generative Generative Generative Generative Generative Generative Generative

8 4 5 5 4 4 4 5 5

1,319 500 448 2,582 688 1,064 2,089 1,351 4,527

Table 10 | Per-benchmark evaluation configuration. The two groups correspond to the general benchmarks and the science-reasoning benchmarks used for math continued pretraining, respectively. “Abbr.” is the abbreviation; “Type” is the capability category; “Format” is the evaluation format, either PPL (likelihood-based scoring) or Generative (free-form generation); “Shots” is the number of in-context examples; “# Examples” is the size of the evaluation set.

Method

ARC-E

ARC-C

MMLU

HellaS.

RACE

WinoG.

OBQA

PIQA

CSQA

SIQA

SciQ

AVG

Raw Rule-based ProX RePro ReWire DataOrchestra

42.40 42.31 43.55 41.53 42.35 44.04

25.09 25.48 25.20 26.34 27.67 26.28

26.58 26.66 27.00 27.28 28.04 27.35

37.20 37.83 38.29 35.43 34.74 38.61

28.74 29.57 28.96 27.81 27.18 29.47

51.57 51.51 50.67 51.07 51.33 52.25

27.93 28.13 26.80 26.40 28.60 29.40

66.81 67.54 67.45 65.61 64.31 67.54

19.60 19.55 19.27 18.76 19.96 20.04

38.74 38.55 38.96 36.86 36.97 37.82

63.00 62.67 63.37 61.57 60.93 62.47

38.88 39.07 39.05 38.06 38.37 39.57

Table 11 | Per-benchmark downstream performance on DCLM-RefinedWeb (0.5B models pretrained from scratch).

Method

ARC-E

ARC-C

MMLU

HellaS.

RACE

WinoG.

OBQA

PIQA

CSQA

SIQA

SciQ

AVG

Raw Rule-based ProX RePro ReWire DataOrchestra

41.44 41.30 41.20 39.93 42.37 44.96

24.72 25.34 25.80 25.65 28.27 26.37

26.79 26.76 26.70 26.76 27.36 27.21

37.82 39.12 38.97 35.56 35.26 38.69

28.42 29.41 28.74 28.42 26.44 28.80

50.78 51.07 51.01 50.88 52.43 51.78

27.87 28.80 28.73 28.73 25.73 31.80

67.65 67.59 67.65 65.05 65.61 67.75

19.57 19.57 19.57 19.96 20.17 19.74

38.30 39.15 38.08 37.46 36.49 38.14

62.87 60.30 59.57 57.50 60.30 61.57

38.75 38.95 38.73 37.81 38.22 39.71

Table 12 | Per-benchmark downstream performance on C4 (0.5B models pretrained from scratch).

28

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

System Prompt You are an **end-to-end pretraining data cleaner**. Given one chunk of a pretraining document, you produce ONE rewritten version that simultaneously handles three categories of issues -- noise pruning, surface rectification, and pedagogical augmentation -- as needed by this specific chunk. You triage what the chunk actually needs and apply only the relevant operations; not every chunk needs every step. ## Document Format Each given document chunk is wrapped in [DOC] / [/DOC] tags. Note: chunks are split by token limits, so the beginning and end may be mid-sentence or mid-paragraph. This is a normal chunking artifact -- do not attempt to complete or extend truncated text at chunk boundaries. ## What to Do ### 1. Noise Pruning Strip clearly off-content material: - Website headers, navigation bars, or menu items (e.g., "Home | About | Contact") - Unrelated HTTP links (e.g., ads, trackers, developer tools) - Generic footers (e.g., contact info, privacy policies, unsubscribe links) - Empty lines, decorative separators (e.g., "---"), or stray punctuation runs For sentences mixing relevant and irrelevant content, remove only the irrelevant fragment if the rest stays coherent; otherwise drop the whole sentence. Never delete meaningful content just because it is short, off-topic-looking at a glance, or stylistically rough -- apply only when content is clearly meaningless. ### 2. Surface Rectification Fix formatting damage and structural breakage WITHOUT inventing new information: - Rejoin sentences and paragraphs that were broken by stray line wraps. - Reconstruct damaged tables, formulas, diagrams, or code blocks that appear as consecutive lines of isolated words, single characters, or short fragments -- use surrounding context to recover the intended structure. - Normalize obviously broken whitespace, bullets, or list markers. Limited contextual inference is permitted strictly for restoring the original structure. This is meaning-preserving -- do NOT alter the substance, paraphrase aggressively, or add knowledge that is not already present. ### 3. Pedagogical augmentation If, after noise removal and surface repair, the content still reads as terse, jargon-heavy, or assumes background a learner may lack, weave in clarifying material: - Make implicit reasoning explicit (the goal, the strategy, why it fits). - Demystify jargon and notation with intuition-building analogies and short examples before the formal explanation. - Illustrate abstract ideas with concrete cases. - Draw bridges to foundational concepts in the broader field. - Anticipate likely learner confusion and flag common misconceptions, as natural mentor-style asides. ALL data, formulas, definitions, theories, experimental results, and logical arguments from the source must be preserved without altering their meaning. Your additions clarify, never contradict. The output must be a self-consistent text that retains elements from the original; do NOT throw away the source and write a fresh explanation from your own knowledge. ## Operating Principles - Triage first. Decide which of the three categories actually apply to this chunk. A clean, well-written chunk may need only minimal augmentation; a heavily polluted chunk may need aggressive noise removal before anything else. - Operations compose in order: noise removal -> surface repair -> pedagogical augmentation. Each later stage should treat the cleaned-up text as its input. - If the chunk after noise removal is empty or trivially short, output the surviving content as-is (or nothing); do not hallucinate a pedagogical narrative from nothing. - Do not announce what you did. Do not include section headers like "Noise removal:" or "Pedagogical augmentation:". The reader only sees the final rewritten chunk.

User Prompt [DOC] {chunk} [/DOC] ## Output Format output ONLY the final rewritten chunk as a self-contained passage of plain text (no introductory or concluding remarks, no commentary on what was changed, no [DOC]/[/DOC] wrappers).

Figure 14 | Prompt for the end-to-end rewriting LLM.

29

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

System Prompt You are a **rewrite verifier** for pretraining-data cleaning. A cleaning specialist has produced an AFTER version of a document chunk from its BEFORE version -- through format-fixing rewriting, or pedagogical augmentation that unpacks implicit reasoning / demystifies jargon / lowers cognitive load, or both. The specialist must not alter the meaning of the original material. You receive two versions of the SAME chunk and must score the rewrite on a 2-item rubric. ## Input format - **BEFORE** -- the chunk before the cleaning pass. - **AFTER** -- the chunk after the cleaning pass. Both BEFORE and AFTER are wrapped in [DOC] / [/DOC]. Chunks are token-bounded slices; mid-sentence ends at chunk boundaries are normal. ## Scoring rubric For each item write `reasoning` first (1-2 sentences), then `score` (the integer `0` or `1` -- `1` means "rubric item passes / no problem"). `no_content_loss` -- Every substantive piece of content in the BEFORE chunk survives in the AFTER chunk. "Substantive" covers facts, numerical values, named entities, definitions, examples, claims, reasoning steps, code, data, etc. Reformatting and interleaving entailed explanatory additions are fine. Removing genuine noisy information is fine and expected -- site navigation, ads, social-share UI, cookie banners, repeated headers/footers, copyright/legal boilerplate, etc. The failure modes to catch: (1) originally-present important information has been deleted, or replaced by a higher-level gloss/summary rather than preserved (e.g. exact numbers, formulas, terminology, quoted phrasing, or code dropped in favour of a paraphrase); (2) the AFTER chunk has been turned into commentary ABOUT the original -- an explanation, description, or meta-discussion of what the BEFORE text says -- rather than remaining a faithful presentation of the text itself, so that the original's own integrity as primary content is lost even if its points are mentioned. `no_factual_error` -- The rewrite introduced no factually incorrect or hallucinated information. Reconstructing damaged content from context, and inserting reasoning steps, intuitions, analogies, or jargon clarifications, are allowed -- but every such addition must be factually correct and entailed by the BEFORE text (or by uncontroversial domain knowledge naturally implied by it). ## Output format Respond with EXACTLY one JSON object and nothing else. If you must use a code fence, use ```json ... ```. ```json { "no_content_loss": "no_factual_error": } ```

{"reasoning": "<sentences>", "score": 0 | 1}, {"reasoning": "<sentences>", "score": 0 | 1}

Each `score` is exactly the integer `0` or `1`. Do NOT add any extra keys.

User Prompt ## BEFORE [DOC] {before_chunk} [/DOC] ## AFTER [DOC] {after_chunk} [/DOC]

Figure 15 | Prompt for the rewriting-quality evaluation used in the ablation, where a teacher LLM judges content preservation and factual correctness of each rewrite.

Method

ARC-E

ARC-C

MMLU

HellaS.

RACE

WinoG.

OBQA

PIQA

CSQA

SIQA

SciQ

AVG

Raw Rule-based ProX RePro ReWire DataOrchestra

41.89 41.84 42.27 41.44 41.26 44.46

24.57 25.20 25.37 25.03 26.31 26.39

27.03 26.70 26.84 27.22 27.78 27.60

38.05 38.48 38.49 35.39 35.04 38.23

29.60 28.23 29.70 27.88 27.88 28.55

51.20 51.91 52.30 50.17 51.80 53.14

28.40 28.33 29.67 27.00 26.20 29.87

67.12 66.96 67.65 65.49 64.96 68.06

19.57 19.57 19.49 20.01 20.64 20.12

38.81 38.86 38.23 37.65 36.27 38.55

63.23 61.93 61.33 61.33 61.83 62.33

39.04 38.91 39.21 38.06 38.18 39.75

Table 13 | Per-benchmark downstream performance on FineWeb (0.5B models pretrained from scratch).

30

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

Method

GSM8K

MATH

GPQA

Base

19.94

11.00

9.19

Raw Rule-based ProX RePro ReWire DataOrchestra

25.04 25.30 25.90 24.64 24.49 25.02

11.13 11.87 11.13 10.73 10.87 12.47

11.29 11.73 12.63 12.18 12.18 13.23

SuperGPQA

SciBench

MMLU-M

MMLU-S

MMLU-Pro-M

MMLU-Pro-S

AVG

8.17

3.34

30.08

26.47

10.29

10.51

14.33

8.89 9.82 8.47 9.44 8.91 8.53

3.97 3.29 3.92 3.00 3.63 3.83

35.06 33.36 35.12 35.46 34.24 35.12

25.43 25.36 25.95 24.99 27.14 30.78

10.78 10.17 11.35 11.40 11.45 12.09

12.27 11.85 11.74 11.86 12.15 12.38

15.99 15.86 16.25 15.97 16.12 17.05

Table 14 | Per-benchmark science-reasoning performance on OpenWebMath (3B continued pretraining). Method

GSM8K

MATH

GPQA

SuperGPQA

SciBench

MMLU-M

MMLU-S

MMLU-Pro-M

MMLU-Pro-S

AVG

Base

19.94

11.00

9.19

8.17

3.34

30.08

26.47

10.29

10.51

14.33

Raw Rule-based ProX RePro ReWire DataOrchestra

26.28 25.68 26.21 26.33 25.78 25.88

12.87 12.07 12.13 11.87 12.07 12.07

12.71 12.18 14.57 11.58 13.08 13.38

9.80 10.33 9.44 9.49 9.48 8.79

3.83 4.12 3.59 3.10 3.88 3.44

35.56 33.49 35.56 36.40 34.12 37.22

25.69 25.34 25.45 25.75 26.76 29.18

11.94 10.81 11.32 11.97 11.70 12.95

11.98 11.62 12.30 12.24 12.08 12.56

16.74 16.18 16.73 16.53 16.55 17.27

Table 15 | Per-benchmark science-reasoning performance on MegaMath (3B continued pretraining). Method

ARC-E

ARC-C

MMLU

HellaS.

RACE

WinoG.

OBQA

PIQA

CSQA

SIQA

SciQ

AVG

Raw ProX RePro RePro + Raw (random) RePro + Raw (fastText) ReWire ReWire + Raw (random) ReWire + Raw (fastText) DataOrchestra DataOrchestra + Raw (random) DataOrchestra + Raw (fastText)

39.39 42.42 39.51 40.87 44.23 42.85 41.92 46.52 44.75 42.86 48.32

23.72 25.11 24.54 24.18 24.49 26.68 24.29 25.14 27.16 25.06 27.62

26.67 27.01 27.13 26.92 27.40 27.48 27.17 28.15 27.60 27.31 28.00

34.99 37.04 34.89 35.45 35.97 34.32 35.47 34.46 36.80 36.28 35.61

28.36 29.31 27.69 28.87 29.41 25.61 28.52 28.23 30.18 29.09 29.09

49.01 52.67 52.80 50.83 53.27 51.83 50.64 50.93 51.88 50.88 52.78

25.87 26.87 25.07 27.13 28.80 26.13 27.20 29.40 29.20 28.53 30.33

65.67 67.03 64.67 65.58 65.58 63.86 65.49 64.60 66.50 66.70 65.80

19.63 19.55 20.48 19.36 20.34 20.17 19.52 20.09 20.56 19.57 20.45

37.50 38.55 37.09 36.81 37.97 37.29 36.56 37.29 38.40 37.39 38.26

63.13 64.47 62.10 63.57 64.37 64.60 62.23 67.33 66.90 64.17 65.23

37.63 39.09 37.81 38.14 39.26 38.26 38.09 39.29 39.99 38.90 40.13

Table 16 | Per-benchmark results for mixing rewritten data with raw data (0.5B, from scratch). “(random)” and “(fastText)” denote how the 10B raw tokens mixed with the 10B rewritten tokens are selected. Method

ARC-E

ARC-C

MMLU

HellaS.

RACE

WinoG.

OBQA

PIQA

CSQA

SIQA

SciQ

AVG

Raw Drop Drop + NP Drop + NP + SR Drop + NP + SR (fastText) Drop + NP + SR + PA Drop + NP + SR + PA (fastText) Drop + E2E Drop + E2E (fastText) DataOrchestra DataOrchestra (fastText)

39.39 42.62 42.42 41.54 44.82 45.45 47.12 43.06 46.83 44.75 48.32

23.72 25.00 25.11 25.71 26.08 28.58 28.01 25.68 26.08 27.16 27.62

26.67 26.76 27.01 27.09 27.48 27.77 27.82 27.56 28.28 28.00 28.00

34.99 36.55 37.04 35.31 36.54 36.19 36.52 35.55 36.68 36.80 35.61

28.36 28.93 29.31 28.68 29.73 28.26 29.25 28.64 29.60 30.18 29.09

49.01 52.43 52.67 51.51 51.20 52.07 51.14 51.22 51.67 51.88 52.78

25.87 27.07 26.87 27.67 28.40 29.20 28.80 28.87 28.13 29.20 30.33

65.67 67.10 67.03 64.87 65.27 65.02 65.03 65.40 65.56 66.50 65.80

19.63 19.82 19.55 19.71 19.60 20.67 21.05 20.09 20.31 20.56 20.45

37.50 37.87 38.55 37.31 37.91 39.01 38.72 37.36 38.52 38.40 38.26

63.13 63.53 64.47 60.97 64.73 63.27 64.60 60.90 64.70 66.90 65.23

37.63 38.88 39.09 38.22 39.25 39.59 39.83 38.58 39.67 40.03 40.13

Table 17 | Per-benchmark results for the multi-stage data-processing pipelines (0.5B, from scratch). “(fastText)” denotes mixing in fastText-selected raw data.

31

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

J. Case Study To give a qualitative sense of the Orchestrator’s behavior, we present several real examples from our pipeline. Figures 16–19 show four good cases, and Figures 20–21 show two bad cases. J.1. Good Cases

Raw Chunk $19.99 Prime Help! (Mono Vinyl) $19.99 Prime With The Beatles $16.12 Prime Help! B00KZ73VKO,B00KZ73UJQ,B00KZ73W30,B00KZ73V0Y,B0025KVLRY,B0025KVLSS,B00KZ73W08,B00KZ73VVI,B00KZ73VU4,B0025KVLTW,B0025KVLUG,B00KZ73 ⌋ UHI,B00KZ73WCG,B0025KVLV0,B0025KVLTC,B0025KVLVA,B0025KVLU6,B0041KVZ1I,B00GJ7ROX4,B00GJ7ROYS,B00GJ7ROV6,B0000DJZA5,B00GJ7RP10,B00 ⌋ GJ7ROVG,B00GJ7ROXY,B000002USZ,B00O64D3HI,B00GJ7RP4C,B007LS09AU,B00GJ7ROT8,B00NSOP7R6,B000002TYZ,B00GBFC470,B00OCPU6SA,B00GJ7RORU ⌋ ,B00M2OZLQK,B00GJ7ROZW,B00F4BJ4M0,B003YNFYCO,B00M30SPMU,B000002TZ2,B003YNFYD8,B00GJ7RP2O,B00GJ7ROQG,B00M30V1YO,B00IXHBZF6,B00F3V ⌋ OL38,B00006AW2O,B005NJ9CHK,B00LWLZRIG,B00004ZAV3,B00IXHBS6M,B00M2OZGMY,B00NF4POZO,B00MG4CUH4,B000002TYX,B007L96VCY,B001B0G5WA,B0 ⌋ 0LRHK3I4,B00KIZ9F8K,B00005NHNX,B00006AW2G,B00NQKWAIQ,B00MI7120K,B003XX2O8C,B00MI711RO,B000RA7IZS,B003Y8YXFS,B00M2OZNBI,B00M5747L ⌋ Y,B00M0CVY3S,B00065XJ48,B000JK8OYU,B0039TD826,B00M574C0U,B00IXHBOF2,B004ZN9T00,B00J2PQYYK,B00AP5KRFI,B000AV2G3I,B00N5NDAB0,B001W ⌋ CN23W,B00MI711QA,B004WJRF6C,B00EVSACLE,B004E9OLZS,B000VSBX34,B00M2D7KGA,B00BO5SP1Q,B004WDPX9Y,B00NVHRB4W,B00IXHBL7I,B006WTINYI,B ⌋ 00006EXDM,B003Y8YXF8,B00KBUEYMY,B00006AW2J,B00M0CVZ82,B00J4A27B2,B00J2PQZEY

Orchestrator Output {

}

"decision": "drop", "noise_pruning": false, "surface_rectification": null, "pedagogical_augmentation": null

Figure 16 | Good case (drop). The chunk is almost entirely Amazon prices and product identifiers, with no usable linguistic or factual content. The Orchestrator drops it.

Raw Chunk "Well, that's when we have an overload of hard-boiled eggs," I replied. "But of course that's not really what you're asking." "No, I guess I'm suggesting that we should make this more often," Mrs K R said. "Fine with me -- we both like it, and it's easy." I chewed thoughtfully. "You know, this new bread recipe you're developing is really good." "It is," Mrs K R agreed. "My recipe for homemade No-Knead Bread is pretty decent. But I found another method that's even better. And we both like whole wheat bread, so I'm developing this whole wheat version." "We should put it up on the blog," I said as I finished my sandwich. "It's not ready for that yet," Mrs K R replied. "We need to test it a bit more -- on egg salad sandwiches!" Looks like we'll be keeping the Easter Bunny hopping for a while longer this year.

Orchestrator Output {

}

"decision": "untouch", "noise_pruning": false, "surface_rectification": null, "pedagogical_augmentation": null

Figure 17 | Good case (untouch). A fluent, self-contained narrative. Any rewriting would risk distorting the author’s voice, so the Orchestrator leaves it unchanged.

32

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

Raw Chunk a lot of data being sent in this single UDP packet, to a high port and from a high source port. In fact, this is an example of a buffer overflow being completed over UDP. So as we have seen, just using a simple three stage approach we were able to understand what was going on with the scenario. There was an initial port scan for UDP services at 9am. This was then followed by a UDP based buffer overflow attack against 192.168.188 at 10:30am. David Stubley 7Elements, We are an independent security consultancy focusing on technical information assurance. Further information on our services can be found here. 7 Elements to run 44Con Burp Suite Workshop Stack Exchange Profiles All data and information provided on this site is for informational purposes only. The opinions expressed by individual Bloggers and those providing comments are theirs alone, and do not reflect the opinions of 7 Elements Ltd. 7 Elements Ltd is not responsible for the accuracy of any of the information supplied by the Bloggers. (c) 2011, 7 Elements Ltd. Awesome Inc. theme. Powered by Blogger.

Orchestrator Output {

}

"decision": "clean", "noise_pruning": true, "surface_rectification": null, "pedagogical_augmentation": "Expand the technical description of UDP-based buffer overflow attacks by adding context about UDP's connectionless nature, its typical use cases (e.g., DNS, RIP), and how such attacks exploit predictable data flows. Ensure all additions are factually grounded in networking principles and do not introduce speculative or unsupported claims."

After NP (8 boilerplate lines removed) a lot of data being sent in this single UDP packet, to a high port and from a high source port. In fact, this is an example of a buffer overflow being completed over UDP. So as we have seen, just using a simple three stage approach we were able to understand what was going on with the scenario. There was an initial port scan for UDP services at 9am. This was then followed by a UDP based buffer overflow attack against 192.168.188 at 10:30am.

After PA (cleaned chunk) A lot of data being sent in this single UDP packet -- destined for a high destination port and originating from a high source port -- is a classic sign of a buffer overflow attack carried out over UDP. This might seem surprising at first, because UDP (User Datagram Protocol) is typically seen as a lightweight, connectionless protocol used for real-time applications like DNS queries, streaming media, or routing protocols such as RIP (Routing Information Protocol), where speed and low overhead are prioritized over reliability. Unlike TCP, which establishes a handshake before sending data and ensures orderly delivery, UDP doesn't require a connection setup or flow control. This makes it inherently less secure -- there's no built-in mechanism to detect or reject malformed or oversized packets. Now, here's the key insight: even though UDP lacks connection establishment, it still operates on predictable patterns. For example, when a device like a router or a DNS server listens on a specific UDP port (say, port 53 for DNS), it will accept incoming datagrams without checking whether they're valid or within expected bounds. Attackers exploit this by crafting oversized packets -- specifically, packets larger than the buffer allocated to handle them -- so that when the receiving service tries to process the data, it writes beyond the end of its memory buffer. This causes a buffer overflow, potentially leading to crashes, unauthorized access, or even remote code execution. In this scenario, the attack unfolds in two stages. First, at 9 a.m., there's a port scan targeting UDP services -- this means the attacker is probing various high ports to see which ones are open and responsive. The fact that the scan happens early suggests reconnaissance phase, where the attacker identifies potential targets. Then, at 10:30 a.m., the actual attack occurs: a UDP-based buffer overflow is launched against the IP address 192.168.188. The use of a high source port and a large payload in a single UDP packet is designed to overwhelm the target's buffer handling logic. Why is this dangerous? Because many legacy systems or poorly implemented UDP services don't validate packet sizes before processing. So, even though UDP is fast and efficient, it becomes a vulnerability vector when developers fail to implement proper input validation and boundary checks. This is especially true in network services like DNS, where a simple query can be abused with a crafted oversized response. In contrast, TCP-based attacks often rely on connection states and sequence numbers, making them harder to launch without being detected. But UDP's lack of state tracking and connection management allows attackers to send massive payloads with minimal effort. So, while this may appear to be a rare or exotic attack, it's actually grounded in real-world vulnerabilities found in older network infrastructure. Understanding this helps us appreciate not just how attacks work, but also why security best practices -like validating all incoming data, using firewalls to block suspicious traffic, and applying patches to known vulnerable services -- are essential in protecting networks from such exploits.

Figure 18 | Good case (NP + PA). NP removes the consultancy footer and blog boilerplate; PA then expands the terse incident description with background on UDP and buffer-overflow attacks, while preserving the original facts (the 9am scan and the 10:30am attack on 192.168.188).

33

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

Raw Chunk [DOC] [000] &gt;&gt;HomeArticlesSign in&nbsp; clickhere [001] ##Photo synthe sis&nbsp;is how\n plant sconvert</p> [002] sun lightinto**energy**.\\It happen s&lt;br&gt;in the [003] chloro plast s wherechloro phyllabsorb slight...||| ... [010] &nbsp;Related:Bio101 <div>Ads by Google</div> [/DOC]

Orchestrator Output {

}

"decision": "clean", "noise_pruning": true, "surface_rectification": "Decode and remove residual HTML entities and tags (e.g., &gt;, &nbsp;, <div>, <br>). Merge fragmented tokens that result from faulty text extraction back into complete words. Strip all non-semantic characters, including navigation boilerplate, markdown syntax, escape sequences, and decorative symbols. Reassemble the cleaned content into fluent, well-formed sentences. Do not alter, add, or remove any factual information.", "pedagogical_augmentation": null

After SR (cleaned chunk) Photosynthesis is how plants convert sunlight into energy. It happens in the chloroplasts, where chlorophyll absorbs light.

Figure 19 | Good case (NP + SR). The extraction is badly corrupted: HTML entities, stray tags, and words split across line breaks. NP finds no clean line-level noise to drop, so SR does the work: it decodes the entities, rejoins the fragmented tokens, and restores two clean sentences without changing the meaning.

34

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

J.2. Bad Cases

Raw Chunk Provence-Alpes-Cote d'Azur France The Gorges du Verdon, located in south-eastern France (Alpes-de-Haute-Provence), is a river canyon, considered to be one of the most beautiful in Europe. It is about 25 km/16 mi long and up to 700 m/2296 ft deep, formed by the Verdon River and named after for its startling turquoise-green colour. Its most impressive part lies between the towns of Castellane and Moustiers-Sainte-Marie while at the end of the canyon, the Verdon River flows into the artificial lake of Sainte-Croix-du-Verdon. How to go Wind Surfing ADD COMMENT Lac de Monteynard, Grenoble Rhone-Alpes France Lac de Monteynard-Avignonet is an artificial water reservoir serving the Electricite de France power station of Drac Station. The reservoir is bounded by the canyons of Ebron and Drac and belongs to the Isere department. It was created in 1961after the built of a 145 m / 476 ft high dam. The reservoir is up to 10 km / 6.3 mi long and in some places reaches at 300 m / 984 ft wide. On the lake, it is often windy and wavy, something that makes it one of the best places to practice water sports. How to go Canyoning ADD COMMENT Durance River, Hautes Alpes Provence-Alpes-Cote d'Azur France Canyoning in the heart of the Southern Alps, in the Hautes Alpes, on the banks of the Durance river, between the Queyras Regional Natural Park in the east, and the largest National French Park, les Ecrins in the West. Wakeboarding ADD COMMENT Rhone-Alpes France Lac de Monteynard-Avignonet is an artificial water reservoir, serving the Electricite de France power station of Drac Station. The reservoir is bounded by the canyons of Ebron and Drac and belongs to the Isere department. It was created in 1961 after the built of a 145 m / 476 ft dam. The reservoir is up to 10 km / 6.3 mi long and in some places it reaches at 300 m / 984 ft wide. On the lake, it is often windy and wavy, something that makes it one of the best places to practice water sports. How to go Saint Crepin, Hautes Alpes Provence-Alpes-Cote d'Azur France Saint-Crepin is situated in the Hautes-Alpes department (Provence Alpes region, Cote d'Azur) in the south-east of France at 45 km/27 mi from Gap, the departmental capital. The village is located near the Durance River, ideal spot for whitewater kayaking or canoeing. How to go Hot Air Ballooning ADD COMMENT Forcalquier, Haute Provence Provence-Alpes-Cote d'Azur France Forcalquier is a commune situated in the Alpes-de-Haute-Provence department, in southeastern France. It is located between the Lure and Luberon mountain ranges, about 30 km / 19 mi south of Sisteron and 10 km / 6.2 mi west of the Durance river. Bungee Jumping ADD COMMENT

Orchestrator Output {

}

"decision": "clean", "noise_pruning": true, "surface_rectification": "Rewrite the document by removing all 'ADD COMMENT' lines and integrating fragmented sentences into coherent paragraphs. Rejoin broken descriptions of geographical locations and ensure all numerical data and proper nouns are preserved exactly.", "pedagogical_augmentation": null

After NP (all 15 lines removed) (empty -- NP deleted every line, including the geographical descriptions)

Figure 20 | Bad case (NP over-pruning). The chunk interleaves genuine geographical descriptions with repeated ADD COMMENT interface lines. NP is meant to strip only the interface noise, but here it deletes every line, including the informative descriptions, leaving an empty chunk. This is an over-pruning failure: NP discards content-bearing text together with the noise.

35

DataOrchestra: Learning to Orchestrate Per-Example Curation of Pretraining Data

Raw Chunk (UniProtKB entry for human IMPA2) Searching in BLASTAlignUpload listsContactHelpYou are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.Basket 0(max 400 entries)xYour basket is currently empty.Select item(s) and click on "Add to basket" to create your own collection here (400 entries max)UniProtKB (0)UniRef (0)UniParc (0)AlignBLASTDownloadFull ViewClearO14732- IMPA2_HUMANUniProtO14732 - IMPA2_HUMANProteinInositol monophosphatase 2GeneIMPA2OrganismHomo sapiens (Human)StatusReviewed - <p>Annotation score: 5 out of 5</p> PublicationsEntry informationMiscellaneousTopBLAST>sp|O14732|IMPA2_HUMAN Inositol monophosphatase 2 OS=Homo sapiens GN=IMPA2 PE=1 SV=1 MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHL VEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSI GFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDP ATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIR EAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK AlignFormatAdd to basketHistoryEntry version 130 (01 Oct 2014)Sequence version 1 (01 Jan 1998)Previous versions | rssHelp videoFeedbackComment Select a section on the left to see content.FunctioniCan use myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates. Has been implicated as the pharmacological target for lithium Li+ action in brain.1 Publication Cited for: FUNCTION, MUTAGENESIS OF ASP-104, ENZYME REGULATION, COFACTOR, BIOPHYSICOCHEMICAL PROPERTIES, HOMODIMERIZATION. Catalytic activityiMyo-inositol phosphate + H2O = myo-inositol + phosphate.CofactoriMagnesium.1 Publication

Orchestrator Output {

}

"decision": "clean", "noise_pruning": false, "surface_rectification": "Reformat the dense, poorly segmented text into clearly separated sections using blank lines. Specifically: (1) separate the 'Catalytic activity' section from the preceding paragraph; (2) ensure that each major section (e.g., 'Cofactor') is visually distinct through spacing.", "pedagogical_augmentation": "Expand the 'Cofactor' section by explaining the role of magnesium as the metal cofactor required for inositol monophosphatase activity: describe how Mg2+ ions coordinate the substrate phosphate group and stabilize the transition state during catalysis, and briefly note the enzyme's relevance as the proposed pharmacological target of lithium. Ensure all additions are factually grounded in established enzymology and do not alter, contradict, or remove any existing functional, catalytic, or sequence data."

After SR Protein: Inositol monophosphatase 2 Gene: IMPA2 Organism: Homo sapiens (Human) Status: Reviewed - Annotation score: 5 out of 5 Function: Can use myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates. Has been implicated as the pharmacological target for lithium Li+ action in brain. Catalytic activity: Myo-inositol phosphate + H2O = myo-inositol + phosphate. Cofactor: Magnesium. (the FASTA accession header, the version metadata, and the full 245-residue amino-acid sequence are silently removed)

Figure 21 | Bad case (SR silent deletion). The instruction asks SR only to separate sections with blank lines. SR applies the requested formatting but also silently deletes the FASTA accession header, the version metadata, and—most damagingly—the full 245-residue amino-acid sequence, the single most valuable item in a UniProt entry. The output reads more fluently than the input, so no downstream quality filter flags the loss. This exposes SR’s bias to treat dense, high-entropy token blocks (sequences, identifiers) as junk and discard them.

36

Record · ID 405685 · SHA-256 befbf6432629a0f8
Retrieved via Conceptio — every document is proof-bundled with source, license, and retrieval metadata.