ConceptioArchiveCode of Federal Regulations (eCFR)
Code of Federal Regulations (eCFR)public full text

5 CFR Part 2470 — General

Office of the Federal Register (NARA) · Code of Federal Regulations (eCFR, Office of the Federal Register)
Code of Federal Regulations (eCFR) · Legal · License: Public Domain
Open Source ↗
administrativefederallaborrelationsauthorityfederalserviceimpassespanelpersonnel
united states, us regulation, us federal regulation, code of federal regulations, cfr, federal regulation, 5, 2470, part 2470, 5 cfr 2470, 5 cfr part 2470, administrative, personnel, federal labor relations authority, general counsel of the federal labor relations authority and federal service impasses panel, federal service impasses panel

PART 2470—GENERAL Authority: 3 U.S.C. 431; 5 U.S.C. 7119, 7134. Subpart A—Purpose § 2470.1 Purpose. The regulations contained in this subchapter are intended to implement the provisions of section 7119 of title 5 and, where applicable, section 431 of title 3 of the United States Code. They prescribe procedures and methods which the Federal Service Impasses Panel may utilize in the resolution of negotiation impasses when voluntary arrangements, including the services of the Federal Mediation and Conciliation Service or any other third-party meditation, fail to resolve the disputes. It is the policy of the Panel to encourage labor and management to resolve disputes on terms that are mutually agreeable at any stage of the Panel's procedures. [63 FR 46159, Aug. 31, 1998] Subpart B—Definitions § 2470.2 Definitions. (a) The terms agency, labor organization, conditions of employment agency (b) The term Executive Director (c) The terms designated representative designee (d) The term hearing (e) The term impasse (f) The term Panel (g) The term party (h) The term quorum (i) The term voluntary arrangements [45 FR 3520, Jan. 17, 1980, as amended at 48 FR 19693, May 2, 1983; 63 FR 46159, Aug. 31, 1998]

Related documents

Record · ID 504181 · SHA-256 246626c735f42cf6
Retrieved via Conceptio — every document is proof-bundled with source, license, and retrieval metadata.