ConceptioArchiveGoogle Patents
Google Patentsopen access

Evolved cas9 proteins for gene editing — President And Fellows Of Harvard College (US20250092374A1)

President And Fellows Of Harvard College · Google Patents
Google Patents · Patents · License: Open Access
Open Source ↗
presidentandfellowsofharvardcollege
patent, google patents, intellectual property, US20250092374A1, President And Fellows Of Harvard College, David R. Liu, en, 2025

ABSTRACT

Abstract

Some aspects of this disclosure provide strategies, systems, reagents, methods, and kits that are useful for engineering Cas9 and Cas9 variants that have increased activity on target sequences that do not contain the canonical PAM sequence. In some embodiments, fusion proteins comprising such Cas9 variants and nucleic acid editing domains, e.g., deaminase domains, are provided.

Description

RELATED APPLICATIONS

This application is a national stage filing under 35 U.S.C. § 371 of international PCT application, PCT/US2016/058345, filed Oct. 22, 2016, which claims priority under 35 U.S.C. § 119 (c) to U.S. provisional patent applications, U.S. Ser. No. 62/245,828 filed Oct. 23, 2015, U.S. Ser. No. 62/279,346 filed Jan. 15, 2016, U.S. Ser. No. 62/311,763 filed Mar. 22, 2016, U.S. Ser. No. 62/322,178 filed Apr. 13, 2016, U.S. Ser. No. 62/357,352 filed Jun. 30, 2016, U.S. Ser. No. 62/370,700 filed Aug. 3, 2016, U.S. Ser. No. 62/398,490 filed Sep. 22, 2016, U.S. Ser. No. 62/408,686 filed Oct. 14, 2016, and U.S. Ser. No. 62/357,332 filed Jun. 30, 2016; each of which is incorporated herein by reference.

REFERENCE TO A SEQUENCE LISTING SUBMITTED AS A TEXT FILE VIA EFS-WEB

The present application contains a Sequence Listing which has been submitted in ASCII format via EFS-Web and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Jun. 28, 2022, is named H082470224US02-SUBSEQ-EPG and is 3,977,840 bytes in size.

BACKGROUND OF THE INVENTION

Targeted editing of nucleic acid sequences, for example, the targeted cleavage or the targeted introduction of a specific modification into genomic DNA, is a highly promising approach for the study of gene function and also has the potential to provide new therapies for human genetic diseases. 1 An ideal nucleic acid editing technology possesses three characteristics: (1) high efficiency of installing the desired modification; (2) minimal off-target activity; and (3) the ability to be programmed to edit precisely any site in a given nucleic acid, e.g., any site within the human genome. 2 Current genome engineering tools, including engineered zinc finger nucleases (ZFNs), 3 transcription activator like effector nucleases (TALENs), 4 and most recently, the RNA-guided DNA endonuclease Cas9,5 effect sequence-specific DNA cleavage in a genome. This programmable cleavage can result in mutation of the DNA at the cleavage site via non-homologous end joining (NHEJ) or replacement of the DNA surrounding the cleavage site via homology-directed repair (HDR). 6,7

One drawback of the current technologies is that both NHEJ and HDR are stochastic processes that typically result in modest gene editing efficiencies as well as unwanted gene alterations that can compete with the desired alteration. 8 Since many genetic diseases in principle can be treated by effecting a specific nucleotide change at a specific location in the genome (for example, a C to T change in a specific codon of a gene associated with a disease), 9 the development of a programmable way to achieve such precise gene editing would represent both a powerful new research tool, as well as a potential new approach to gene editing-based human therapeutics.

Another drawback of current genome engineering tools is that they are limited with respect to the DNA sequences that can be targeted. When using ZNFs or TALENS, a new protein must be generated for each individual target sequence. While Cas9 can be targeted to virtually any target sequence by providing a suitable guide RNA, Cas9 technology is still limited with respect to the sequences that can be targeted by a strict requirement for a protospacer-adjacent motif (PAM), typically of the nucleotide sequence 5′-NGG-3′, that must be present immediately adjacent to the 3′-end of the targeted DNA sequence in order for the Cas9 protein to bind and act upon the target sequence. The PAM requirement thus limits the sequences that can be efficiently targeted by Cas9 proteins.

SUMMARY OF THE INVENTION

Significantly, 80-90% of protein mutations responsible for human disease arise from the substitution, deletion, or insertion of only a single nucleotide. 6 Most current strategies for single-base gene correction include engineered nucleases (which rely on the creation of double-strand breaks, DSBs, followed by stochastic, inefficient homology-directed repair, HDR), and DNA-RNA chimeric oligonucleotides. 22 The latter strategy involves the design of a RNA/DNA sequence to base pair with a specific sequence in genomic DNA except at the nucleotide to be edited. The resulting mismatch is recognized by the cell's endogenous repair system and fixed, leading to a change in the sequence of either the chimera or the genome. Both of these strategies suffer from low gene editing efficiencies and unwanted gene alterations, as they are subject to both the stochasticity of HDR and the competition between HDR and non-homologous end-joining, NHEJ. 23-25 HDR efficiencies vary according to the location of the target gene within the genome, 26 the state of the cell cycle, 27 and the type of cell/tissue. 28 The development of a direct, programmable way to install a specific type of base modification at a precise location in genomic DNA with enzyme-like efficiency and no stochasticity therefore represents a powerful new approach to gene editing-based research tools and human therapeutics.

The clustered regularly interspaced short palindromic repeat (CRISPR) system is a recently discovered prokaryotic adaptive immune system 10 that has been modified to enable robust and general genome engineering in a variety of organisms and cell lines. 11 CRISPR-Cas (CRISPR-associated) systems are protein-RNA complexes that use an RNA molecule (sgRNA) as a guide to localize the complex to a target DNA sequence via base-pairing. 12 In the natural systems, a Cas protein then acts as an endonuclease to cleave the targeted DNA sequence. 13 The target DNA sequence must be both complementary to the sgRNA and also contain a “protospacer-adjacent motif” (PAM) at the 3′-end of the complementary region in order for the system to function. 14 The requirement for a PAM sequence limits the use of Cas9 technology, since not all desired targeted sequences include a PAM sequence at the 3′-end and thus cannot efficiently be targeted by wild-type Cas9 proteins.

Provided herein are novel Cas9 variants that exhibit activity on target sequences that do not include the canonical PAM sequence (5′-NGG-3′, where N is any nucleotide) at the 3′-end. Such Cas9 variants are not restricted to target sequences that include the canonical PAM sequence at the 3′-end.

Among the known Cas proteins, Streptococcus pyogenes Cas9 has been mostly widely used as a tool for genome engineering. 15 This Cas9 protein is a large, multi-domain protein containing two distinct nuclease domains. Point mutations can be introduced into Cas9 to abolish nuclease activity, resulting in a dead Cas9 (dCas9) that still retains its ability to bind DNA in a sgRNA-programmed manner. 16 In principle, such Cas9 variants, when fused to another protein or domain, can target that protein to virtually any DNA sequence simply by co-expression with an appropriate sgRNA. Thus, this disclosure also contemplates fusion proteins comprising such Cas9 variants and a DNA modifying domain (e.g., a deaminase, a nuclease, a nickase, a recombinase, a methyltransferase, a methylase, an acetylase, an acetyltransferase, a transcriptional activator, or a transcriptional repressor domain), as well as the use of such fusion proteins in correcting mutations in a genome (e.g., the genome of a human subject) that are associated with disease, or generating mutations in a genome (e.g., the human genome) to decrease or prevent expression of a gene.

In some embodiments, any of the Cas9 proteins provided herein may be fused to a protein that has an enzymatic activity. In some embodiments, the enzymatic activity modifies a target DNA. In some embodiments, the enzymatic activity is nuclease activity, methyltransferase activity, demethylase activity, DNA repair activity, DNA damage activity, deamination activity, dismutase activity, alkylation activity, depurination activity, oxidation activity, pyrimidine dimer forming activity, integrase activity, transposase activity, recombinase activity, polymerase activity, ligase activity, helicase activity, photolyase activity or glycosylase activity. In some cases, the enzymatic activity is nuclease activity. In some cases, the nuclease activity introduces a double strand break in the target DNA. In some cases, the enzymatic activity modifies a target polypeptide associated with the target DNA. In some cases, the enzymatic activity is methyltransferase activity, demethylase activity, acetyltransferase activity, deacetylase activity, kinase activity, phosphatase activity, ubiquitin ligase activity, deubiquitinating activity, adenylation activity, deadenylation activity, SUMOylating activity, deSUMOylating activity, ribosylation activity, deribosylation activity, myristoylation activity or demyristoylation activity. In some cases, the target polypeptide is a histone and the enzymatic activity is methyltransferase activity, demethylase activity, acetyltransferase activity, deacetylase activity, kinase activity, phosphatase activity, ubiquitin ligase activity or deubiquitinating activity.

In some embodiments, any of the Cas9 proteins provided herein may be fused to a protein that has an enzymatic activity. In some embodiments, the enzymatic activity modifies a polypeptide associated with DNA (e.g. a histone). In some embodiments, the enzymatic activity is methyltransferase activity, demethylase activity, acetyltransferase activity, deacetylase activity, kinase activity, phosphatase activity, ubiquitin ligase activity (i.e., ubiquitination activity), deubiquitinating activity, adenylation activity, deadenylation activity, SUMOylating activity, deSUMOylating activity, ribosylation activity, deribosylation activity, myristoylation activity, demyristoylation activity glycosylation activity (e.g., from O-GlcNAc transferase) or deglycosylation activity. The enzymatic activities listed herein catalyze covalent modifications to proteins. Such modifications are known in the art to alter the stability or activity of the target protein (e.g., phosphorylation due to kinase activity can stimulate or silence protein activity depending on the target protein). Of particular interest as protein targets are histones. Histone proteins are known in the art to bind DNA and form complexes known as nucleosomes. Histones can be modified (e.g., by methylation, acetylation, ubuitination, phosphorylation) to elicit structural changes in the surrounding DNA, thus controlling the accessibility of potentially large portions of DNA to interacting factors such as transcription factors, polymerases and the like. A single histone can be modified in many different ways and in many different combinations (e.g., trimethylation of lysine 27 of histone 3, H3K27, is associated with DNA regions of repressed transcription while trimethylation of lysine 4 of histone 3, H3K4, is associated with DNA regions of active transcription). Thus, a site-directed modifying polypeptide with histone-modifying activity finds use in the site specific control of DNA structure and can be used to alter the histone modification pattern in a selected region of target DNA. Such methods find use in both research and clinical applications.

In some embodiments, the deaminase domain catalyzes the removal of an amine group from a molecule. In further embodiments, cytidine deaminase domains deaminate cytosine to yield uracil. In other embodiments, the nuclease domain has enzymatic activity and may cleave phosphodiester bonds between the nucleotide subunits of nucleic acids. In some embodiments, recombinase domains, which recombine specific sequences of DNA, may be used to manipulate the structure of genomes and to control gene expression. In further embodiments, methylase domains may be utilized to methylate their respective substrates, while acetylase domains may be used to acetylate their respective substrates. In other embodiments, acetyltransferase domains may be used to transfer an acetyl group. Examples of acetyltransferase molecules include, but are not limited to, histone acetyltransferases (e.g., CBP histone acetyltransferase), choline acetyltransferase, chloramphenicol acetytransferase, serotonic N-acetyltransferase, NatA acetyltransferase, and NatB acetyltransferase. The disclosure also contemplates transcriptional activator and transcriptional repressor domains. Transcriptional activator domains are regions of a transcription factor which may activate transcription from a promoter through an interaction or multiple interactions with a DNA binding domain, general transcription factors, and RNA polymerase. Transcriptional repressor domains are regions of a transcription factor which may repress transcription from a protomer through an interaction or multiple interactions with a DNA binding domain, general transcription factors, and RNA polymerase.

The potential of the Cas9 system for genome engineering is immense. Its unique ability to bring proteins to specific sites in a genome programmed by the sgRNA can be developed into a variety of site-specific genome engineering tools beyond nucleases, including transcriptional activators, transcriptional repressors, histone-modifying proteins, integrases, deaminases, and recombinases. 11 Some of these potential applications have recently been implemented through dCas9 fusions with transcriptional activators to afford RNA-guided transcriptional activators, 17,18 transcriptional repressors, 16,19,20 and chromatin modification enzymes. 21 Simple co-expression of these fusions with a variety of sgRNAs results in specific expression of the target genes. These seminal studies have paved the way for the design and construction of readily programmable sequence-specific effectors for the precise manipulation of genomes.

Some aspects of this disclosure provide strategies, systems, proteins, nucleic acids, compositions, cells, reagents, methods, and kits that are useful for the targeted binding, editing, and/or cleaving of nucleic acids, including editing a single site within a subject's genome, e.g., a human subject's genome. In some embodiments, recombinant Cas9 proteins are provided that comprise at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten mutations as compared to a naturally occurring Cas9 protein, and that exhibit activity on target sequences that do not include the canonical PAM (5′-NGG-3′, where N is any nucleotide) at the 3′-end. Examples of such Cas9 protein mutations are given in Tables 3, 5, 8, and 9. In some embodiments, fusion proteins of Cas9 and nucleic acid editing enzymes or enzymatic domains, e.g., deaminase domains, are provided. In some embodiments, methods for targeted nucleic acid binding, editing, and/or cleaving are provided. In some embodiments, reagents and kits for the generation of targeted nucleic acid binding, editing, and/or cleaving proteins, e.g., fusion proteins of Cas9 variants and nucleic acid editing enzymes or domains, are provided.

Some aspects of this disclosure provide recombinant Cas9 proteins comprising an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to the amino acid sequence of Cas9 as provided by any of the sequences set forth in SEQ ID NOs: 9-262, wherein the amino acid sequence of the Cas9 protein comprises at least one, at least two, at least three, at least four, at least five, at least six, or at least seven mutations in an amino acid residue selected from the group consisting of amino acid residues 122, 137, 182, 262, 294, 409, 480, 543, 660, 694, 1219, and 1329 of S. pyogenes Cas9 having the amino acid sequence provided in SEQ ID NO: 9, or in a corresponding amino acid residue in any of the amino acid sequences provided in SEQ ID NOs: 10-262. In some embodiments, the recombinant Cas9 protein comprises a RuvC and an HNH domain. In some embodiments, the amino acid sequence of the recombinant Cas9 protein is not identical to the amino acid sequence of a naturally occurring Cas9 protein. In some embodiments, the amino acid sequence of the Cas9 protein comprises at least one, at least two, at least three, at least four, at least five, at least six, or at least seven mutations selected from

RELATED APPLICATIONS

This application is a national stage filing under 35 U.S.C. § 371 of international PCT application, PCT/US2016/058345, filed Oct. 22, 2016, which claims priority under 35 U.S.C. § 119 (c) to U.S. provisional patent applications, U.S. Ser. No. 62/245,828 filed Oct. 23, 2015, U.S. Ser. No. 62/279,346 filed Jan. 15, 2016, U.S. Ser. No. 62/311,763 filed Mar. 22, 2016, U.S. Ser. No. 62/322,178 filed Apr. 13, 2016, U.S. Ser. No. 62/357,352 filed Jun. 30, 2016, U.S. Ser. No. 62/370,700 filed Aug. 3, 2016, U.S. Ser. No. 62/398,490 filed Sep. 22, 2016, U.S. Ser. No. 62/408,686 filed Oct. 14, 2016, and U.S. Ser. No. 62/357,332 filed Jun. 30, 2016; each of which is incorporated herein by reference.

REFERENCE TO A SEQUENCE LISTING SUBMITTED AS A TEXT FILE VIA EFS-WEB

The present application contains a Sequence Listing which has been submitted in ASCII format via EFS-Web and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Jun. 28, 2022, is named H082470224US02-SUBSEQ-EPG and is 3,977,840 bytes in size.

BACKGROUND OF THE INVENTION

Targeted editing of nucleic acid sequences, for example, the targeted cleavage or the targeted introduction of a specific modification into genomic DNA, is a highly promising approach for the study of gene function and also has the potential to provide new therapies for human genetic diseases. 1 An ideal nucleic acid editing technology possesses three characteristics: (1) high efficiency of installing the desired modification; (2) minimal off-target activity; and (3) the ability to be programmed to edit precisely any site in a given nucleic acid, e.g., any site within the human genome. 2 Current genome engineering tools, including engineered zinc finger nucleases (ZFNs), 3 transcription activator like effector nucleases (TALENs), 4 and most recently, the RNA-guided DNA endonuclease Cas9,5 effect sequence-specific DNA cleavage in a genome. This programmable cleavage can result in mutation of the DNA at the cleavage site via non-homologous end joining (NHEJ) or replacement of the DNA surrounding the cleavage site via homology-directed repair (HDR). 6,7

One drawback of the current technologies is that both NHEJ and HDR are stochastic processes that typically result in modest gene editing efficiencies as well as unwanted gene alterations that can compete with the desired alteration. 8 Since many genetic diseases in principle can be treated by effecting a specific nucleotide change at a specific location in the genome (for example, a C to T change in a specific codon of a gene associated with a disease), 9 the development of a programmable way to achieve such precise gene editing would represent both a powerful new research tool, as well as a potential new approach to gene editing-based human therapeutics.

Another drawback of current genome engineering tools is that they are limited with respect to the DNA sequences that can be targeted. When using ZNFs or TALENS, a new protein must be generated for each individual target sequence. While Cas9 can be targeted to virtually any target sequence by providing a suitable guide RNA, Cas9 technology is still limited with respect to the sequences that can be targeted by a strict requirement for a protospacer-adjacent motif (PAM), typically of the nucleotide sequence 5′-NGG-3′, that must be present immediately adjacent to the 3′-end of the targeted DNA sequence in order for the Cas9 protein to bind and act upon the target sequence. The PAM requirement thus limits the sequences that can be efficiently targeted by Cas9 proteins.

SUMMARY OF THE INVENTION

Significantly, 80-90% of protein mutations responsible for human disease arise from the substitution, deletion, or insertion of only a single nucleotide. 6 Most current strategies for single-base gene correction include engineered nucleases (which rely on the creation of double-strand breaks, DSBs, followed by stochastic, inefficient homology-directed repair, HDR), and DNA-RNA chimeric oligonucleotides. 22 The latter strategy involves the design of a RNA/DNA sequence to base pair with a specific sequence in genomic DNA except at the nucleotide to be edited. The resulting mismatch is recognized by the cell's endogenous repair system and fixed, leading to a change in the sequence of either the chimera or the genome. Both of these strategies suffer from low gene editing efficiencies and unwanted gene alterations, as they are subject to both the stochasticity of HDR and the competition between HDR and non-homologous end-joining, NHEJ. 23-25 HDR efficiencies vary according to the location of the target gene within the genome, 26 the state of the cell cycle, 27 and the type of cell/tissue. 28 The development of a direct, programmable way to install a specific type of base modification at a precise location in genomic DNA with enzyme-like efficiency and no stochasticity therefore represents a powerful new approach to gene editing-based research tools and human therapeutics.

The clustered regularly interspaced short palindromic repeat (CRISPR) system is a recently discovered prokaryotic adaptive immune system 10 that has been modified to enable robust and general genome engineering in a variety of organisms and cell lines. 11 CRISPR-Cas (CRISPR-associated) systems are protein-RNA complexes that use an RNA molecule (sgRNA) as a guide to localize the complex to a target DNA sequence via base-pairing. 12 In the natural systems, a Cas protein then acts as an endonuclease to cleave the targeted DNA sequence. 13 The target DNA sequence must be both complementary to the sgRNA and also contain a “protospacer-adjacent motif” (PAM) at the 3′-end of the complementary region in order for the system to function. 14 The requirement for a PAM sequence limits the use of Cas9 technology, since not all desired targeted sequences include a PAM sequence at the 3′-end and thus cannot efficiently be targeted by wild-type Cas9 proteins.

Provided herein are novel Cas9 variants that exhibit activity on target sequences that do not include the canonical PAM sequence (5′-NGG-3′, where N is any nucleotide) at the 3′-end. Such Cas9 variants are not restricted to target sequences that include the canonical PAM sequence at the 3′-end.

Among the known Cas proteins, Streptococcus pyogenes Cas9 has been mostly widely used as a tool for genome engineering. 15 This Cas9 protein is a large, multi-domain protein containing two distinct nuclease domains. Point mutations can be introduced into Cas9 to abolish nuclease activity, resulting in a dead Cas9 (dCas9) that still retains its ability to bind DNA in a sgRNA-programmed manner. 16 In principle, such Cas9 variants, when fused to another protein or domain, can target that protein to virtually any DNA sequence simply by co-expression with an appropriate sgRNA. Thus, this disclosure also contemplates fusion proteins comprising such Cas9 variants and a DNA modifying domain (e.g., a deaminase, a nuclease, a nickase, a recombinase, a methyltransferase, a methylase, an acetylase, an acetyltransferase, a transcriptional activator, or a transcriptional repressor domain), as well as the use of such fusion proteins in correcting mutations in a genome (e.g., the genome of a human subject) that are associated with disease, or generating mutations in a genome (e.g., the human genome) to decrease or prevent expression of a gene.

In some embodiments, any of the Cas9 proteins provided herein may be fused to a protein that has an enzymatic activity. In some embodiments, the enzymatic activity modifies a target DNA. In some embodiments, the enzymatic activity is nuclease activity, methyltransferase activity, demethylase activity, DNA repair activity, DNA damage activity, deamination activity, dismutase activity, alkylation activity, depurination activity, oxidation activity, pyrimidine dimer forming activity, integrase activity, transposase activity, recombinase activity, polymerase activity, ligase activity, helicase activity, photolyase activity or glycosylase activity. In some cases, the enzymatic activity is nuclease activity. In some cases, the nuclease activity introduces a double strand break in the target DNA. In some cases, the enzymatic activity modifies a target polypeptide associated with the target DNA. In some cases, the enzymatic activity is methyltransferase activity, demethylase activity, acetyltransferase activity, deacetylase activity, kinase activity, phosphatase activity, ubiquitin ligase activity, deubiquitinating activity, adenylation activity, deadenylation activity, SUMOylating activity, deSUMOylating activity, ribosylation activity, deribosylation activity, myristoylation activity or demyristoylation activity. In some cases, the target polypeptide is a histone and the enzymatic activity is methyltransferase activity, demethylase activity, acetyltransferase activity, deacetylase activity, kinase activity, phosphatase activity, ubiquitin ligase activity or deubiquitinating activity.

In some embodiments, any of the Cas9 proteins provided herein may be fused to a protein that has an enzymatic activity. In some embodiments, the enzymatic activity modifies a polypeptide associated with DNA (e.g. a histone). In some embodiments, the enzymatic activity is methyltransferase activity, demethylase activity, acetyltransferase activity, deacetylase activity, kinase activity, phosphatase activity, ubiquitin ligase activity (i.e., ubiquitination activity), deubiquitinating activity, adenylation activity, deadenylation activity, SUMOylating activity, deSUMOylating activity, ribosylation activity, deribosylation activity, myristoylation activity, demyristoylation activity glycosylation activity (e.g., from O-GlcNAc transferase) or deglycosylation activity. The enzymatic activities listed herein catalyze covalent modifications to proteins. Such modifications are known in the art to alter the stability or activity of the target protein (e.g., phosphorylation due to kinase activity can stimulate or silence protein activity depending on the target protein). Of particular interest as protein targets are histones. Histone proteins are known in the art to bind DNA and form complexes known as nucleosomes. Histones can be modified (e.g., by methylation, acetylation, ubuitination, phosphorylation) to elicit structural changes in the surrounding DNA, thus controlling the accessibility of potentially large portions of DNA to interacting factors such as transcription factors, polymerases and the like. A single histone can be modified in many different ways and in many different combinations (e.g., trimethylation of lysine 27 of histone 3, H3K27, is associated with DNA regions of repressed transcription while trimethylation of lysine 4 of histone 3, H3K4, is associated with DNA regions of active transcription). Thus, a site-directed modifying polypeptide with histone-modifying activity finds use in the site specific control of DNA structure and can be used to alter the histone modification pattern in a selected region of target DNA. Such methods find use in both research and clinical applications.

In some embodiments, the deaminase domain catalyzes the removal of an amine group from a molecule. In further embodiments, cytidine deaminase domains deaminate cytosine to yield uracil. In other embodiments, the nuclease domain has enzymatic activity and may cleave phosphodiester bonds between the nucleotide subunits of nucleic acids. In some embodiments, recombinase domains, which recombine specific sequences of DNA, may be used to manipulate the structure of genomes and to control gene expression. In further embodiments, methylase domains may be utilized to methylate their respective substrates, while acetylase domains may be used to acetylate their respective substrates. In other embodiments, acetyltransferase domains may be used to transfer an acetyl group. Examples of acetyltransferase molecules include, but are not limited to, histone acetyltransferases (e.g., CBP histone acetyltransferase), choline acetyltransferase, chloramphenicol acetytransferase, serotonic N-acetyltransferase, NatA acetyltransferase, and NatB acetyltransferase. The disclosure also contemplates transcriptional activator and transcriptional repressor domains. Transcriptional activator domains are regions of a transcription factor which may activate transcription from a promoter through an interaction or multiple interactions with a DNA binding domain, general transcription factors, and RNA polymerase. Transcriptional repressor domains are regions of a transcription factor which may repress transcription from a protomer through an interaction or multiple interactions with a DNA binding domain, general transcription factors, and RNA polymerase.

The potential of the Cas9 system for genome engineering is immense. Its unique ability to bring proteins to specific sites in a genome programmed by the sgRNA can be developed into a variety of site-specific genome engineering tools beyond nucleases, including transcriptional activators, transcriptional repressors, histone-modifying proteins, integrases, deaminases, and recombinases. 11 Some of these potential applications have recently been implemented through dCas9 fusions with transcriptional activators to afford RNA-guided transcriptional activators, 17,18 transcriptional repressors, 16,19,20 and chromatin modification enzymes. 21 Simple co-expression of these fusions with a variety of sgRNAs results in specific expression of the target genes. These seminal studies have paved the way for the design and construction of readily programmable sequence-specific effectors for the precise manipulation of genomes.

Some aspects of this disclosure provide strategies, systems, proteins, nucleic acids, compositions, cells, reagents, methods, and kits that are useful for the targeted binding, editing, and/or cleaving of nucleic acids, including editing a single site within a subject's genome, e.g., a human subject's genome. In some embodiments, recombinant Cas9 proteins are provided that comprise at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten mutations as compared to a naturally occurring Cas9 protein, and that exhibit activity on target sequences that do not include the canonical PAM (5′-NGG-3′, where N is any nucleotide) at the 3′-end. Examples of such Cas9 protein mutations are given in Tables 3, 5, 8, and 9. In some embodiments, fusion proteins of Cas9 and nucleic acid editing enzymes or enzymatic domains, e.g., deaminase domains, are provided. In some embodiments, methods for targeted nucleic acid binding, editing, and/or cleaving are provided. In some embodiments, reagents and kits for the generation of targeted nucleic acid binding, editing, and/or cleaving proteins, e.g., fusion proteins of Cas9 variants and nucleic acid editing enzymes or domains, are provided.

Some aspects of this disclosure provide recombinant Cas9 proteins comprising an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to the amino acid sequence of Cas9 as provided by any of the sequences set forth in SEQ ID NOs: 9-262, wherein the amino acid sequence of the Cas9 protein comprises at least one, at least two, at least three, at least four, at least five, at least six, or at least seven mutations in an amino acid residue selected from the group consisting of amino acid residues 122, 137, 182, 262, 294, 409, 480, 543, 660, 694, 1219, and 1329 of S. pyogenes Cas9 having the amino acid sequence provided in SEQ ID NO: 9, or in a corresponding amino acid residue in any of the amino acid sequences provided in SEQ ID NOs: 10-262. In some embodiments, the recombinant Cas9 protein comprises a RuvC and an HNH domain. In some embodiments, the amino acid sequence of the recombinant Cas9 protein is not identical to the amino acid sequence of a naturally occurring Cas9 protein. In some embodiments, the amino acid sequence of the Cas9 protein comprises at least one, at least two, at least three, at least four, at least five, at least six, or at least seven mutations selected from the group consisting of X262T, X294R, X409I, X480K, X543D, X694I, and X1219V of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid. In some embodiments, the amino acid sequence of the Cas9 protein comprises at least one, at least two, at least three, at least four, at least five, at least six, or at least seven mutations selected from the group consisting of A262T, K294R, S409I, E480K, E543D, M694I, and E1219V of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262.

Other aspects of this disclosure provide recombinant Cas9 proteins comprising an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to the amino acid sequence of Cas9 as provided by any of the sequences set forth in SEQ ID NOs: 10-262, wherein the amino acid sequence of the Cas9 protein comprises at least one, at least two, at least three, at least four, at least five, at least six, or at least seven mutations in an amino acid residue selected from the group consisting of amino acid residues 262, 267, 294, 405, 409, 480, 543, 694, 1219, 1224, 1256, and 1362 of the amino acid sequence provided in SEQ ID NO: 9, or in a corresponding amino acid residue in any of the amino acid sequences provided in SEQ ID NOS: 10-262; and wherein the amino acid sequence of the recombinant Cas9 protein is not identical to the amino acid sequence of a naturally occurring Cas9 protein. In some embodiments, the Cas9 protein comprises a RuvC and an HNH domain. In some embodiments, the amino acid sequence of the Cas9 protein comprises at least one, at least two, at least three, at least four, at least five, at least six, or at least seven mutations selected from the group consisting of X262T, X267G, X294R, X405I, X409I, X480K, X543D, X694I, X1219V, X1224K, and X1256K of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid. In some embodiments, the amino acid sequence of the Cas9 protein comprises at least one, at least two, at least three, at least four, at least five, at least six, or at least seven mutations selected from the group consisting of A262T, S267G, K294R, F405I, S409I, E480K, E543D, M694I, E1219V, N1224K, and Q1256K of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in in SEQ ID NOs: 10-262.

It should be appreciated that any of the amino acid mutations described herein, (e.g., A262T) from a first amino acid residue (e.g., A) to a second amino acid residue (e.g., T) may also include mutations from the first amino acid residue to an amino acid residue that is similar to (e.g., conserved) the second amino acid residue. For example, a mutation of an alanine to a threonine (e.g., a A262T mutation) may also be a mutation from an alanine to an amino acid that is similar in size and chemical properties to a threonine, for example, serine. Additional similar amino acid pairs include, but are not limited to, the following: phenylalanine and tyrosine; asparagine and glutamine; methionine and cysteine; aspartic acid and glutamic acid; and arginine and lysine. The skilled artisan would recognize that such conservative amino acid substitutions will likely have minor effects on protein structure and are likely to be well tolerated without compromising function. In some embodiments, any of the amino acid mutations provided herein from one amino acid to a threonine may be an amino acid mutation to a serine. In some embodiments, any of the amino acid mutations provided herein from one amino acid to an arginine may be an amino acid mutation to a lysine. In some embodiments, any of the amino acid mutations provided herein from one amino acid to an isoleucine may be an amino acid mutation to an alanine, valine, methionine, or leucine. In some embodiments, any of the amino acid mutations provided herein from one amino acid to a lysine may be an amino acid mutation to an arginine. In some embodiments, any of the amino acid mutations provided herein from one amino acid to an aspartic acid may be an amino acid mutation to a glutamic acid or asparagine. In some embodiments, any of the amino acid mutations provided herein from one amino acid to a valine may be an amino acid mutation to an alanine, isoleucine, methionine, or leucine. In some embodiments, any of the amino acid mutations provided herein from one amino acid to a glycine may be an amino acid mutation to an alanine. It should be appreciated, however, that additional conserved amino acid residues would be recognized by the skilled artisan and any of the amino acid mutations to other conserved amino acid residues are also within the scope of this disclosure.

In some embodiments, the Cas9 protein is a Cas9 domain of a fusion protein. In some embodiments, the amino acid sequence of the Cas9 protein comprises an X1219V mutation of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid. In some embodiments, the mutation is X1219A, X1219I, X1219M, or X1219L.

In some embodiments, the amino acid sequence of the Cas9 protein comprises an E1219V mutation of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262. In some embodiments, the mutation is E1219A, E1219I, E1219M or E1219L.

In some embodiments, the amino acid sequence of the Cas9 protein comprises an X480K mutation of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid. In some embodiments, the mutation is X480R.

In some embodiments, the amino acid sequence of the Cas9 protein comprises an E480K mutation of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262. In some embodiments, the mutation is E480R.

In some embodiments, the amino acid sequence of the Cas9 protein comprises an X543D mutation of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid. In some embodiments, the mutation is X543N.

In some embodiments, the amino acid sequence of the Cas9 protein comprises an E543D mutation of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262. In some embodiments, the mutation is E543N.

In some embodiments, the amino acid sequence of the Cas9 protein comprises the mutations X480K, X543D, and X1219V of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid.

In some embodiments, the amino acid sequence of the Cas9 protein comprises the mutations X262T, X409I, X480K, X543D, X694I, and X1219V of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid.

In some embodiments, the amino acid sequence of the Cas9 protein comprises the mutations X294R, X480K, X543D, X1219V, X1256K, and X1362P of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid.

In some embodiments, the amino acid sequence of the Cas9 protein comprises the mutations X294R, X480K, X543D, X1219V, and X1256K of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid.

In some embodiments, the amino acid sequence of the Cas9 protein comprises the mutations X267G, X294R, X480K, X543D, X1219V, X1224K, and X1256K of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid.

In some embodiments, the amino acid sequence of the Cas9 protein comprises the mutations X262T, X405I, X409I, X480K, X543D, X694I, and X1219V of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid.

In some embodiments, the amino acid sequence of the Cas9 protein comprises the mutations E480K, E543D, and E1219V of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262.

In some embodiments, the amino acid sequence of the Cas9 protein comprises the mutations A262T, S409I, E480K, E543D, M694I, and E1219V of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262.

In some embodiments, the amino acid sequence of the Cas9 protein comprises the mutations K294R, E480K, E543D, E1219V, Q1256K, and L1362P of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262.

In some embodiments, the amino acid sequence of the Cas9 protein comprises the mutations K294R, E480K, E543D, E1219V, and Q1256K of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262.

In some embodiments, the amino acid sequence of the Cas9 protein comprises the mutations S267G, K294R, E480K, E543D, E1219V, N1224K, and Q1256K of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262.

In some embodiments, the amino acid sequence of the Cas9 protein comprises the mutations A262T, F405I, S409I, E480K, E543D, M694I, and E1219V of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262.

The HNH nuclease domain of Cas9 functions to cleave the DNA strand complementary to the guide RNA (gRNA). Its active site consists of a ββα-metal fold, and its histidine 840 activates a water molecule to attack the scissile phosphate, which is more electrophilic due to coordination with a magnesium ion, resulting in cleavage of the 3′-5′ phosphate bond. In some embodiments, the amino acid sequence of the HNH domain is at least 80%, at least 85%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to the amino acid sequence of the HNH domain of any of SEQ ID NOs: 9-262. In some embodiments, the amino acid sequence of the HNH domain is identical to the amino acid sequence of the HNH domain of any of SEQ ID NOs: 9-262.

The RuvC domain of Cas9 cleaves the non-target DNA strand. It is encoded by sequentially disparate sites which interact in the tertiary structure to form the RuvC cleavage domain and consists of an RNase H fold structure. In some embodiments, the amino acid sequence of the RuvC domain is at least 80%, at least 85%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to the amino acid sequence of the RuvC domain of any of SEQ ID NOs: 9-262. In some embodiments, the amino acid sequence of the RuvC domain is identical to the amino acid sequence of the RuvC domain of any of SEQ ID NOs: 9-262.

In some embodiments, the Cas9 protein comprises one or more mutations that affects (e.g., inhibits) the ability of Cas9 to cleave one or both strands of a DNA duplex. In some embodiments, the Cas9 protein comprises a D10A and/or a H840A mutation of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262. In some embodiments, the Cas9 protein comprises a D10X 1 and/or a H840X 2 mutation of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X1 is any amino acid except for D, and X 2 is any amino acid except for H. In some embodiments, the Cas9 protein comprises an D10A mutation of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262. In some embodiments, the Cas9 protein comprises an H at amino acid residue 840 of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding residue in any of the amino acid sequences provided in SEQ ID NOs: 10-262. In some embodiments, the Cas9 protein comprises an H840A mutation of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262. In some embodiments, the Cas9 protein comprises a D at amino acid residue 10 of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding residue in any of the amino acid sequences provided in SEQ ID NOs: 10-262.

In some embodiments, the Cas9 protein of the present disclosure exhibits activity, for example, increased binding, on a target sequence that does not include the canonical PAM sequence (5′-NGG-3′) at its 3′-end as compared to Streptococcus pyogenes Cas9 as provided by SEQ ID NO: 9.

Some aspects of this disclosure provide recombinant Cas9 proteins comprising an amino acid sequence that is at least 90% identical to the amino acid sequence of Streptococcus pyogenes Cas9 as provided by SEQ ID NO: 9 wherein the amino acid sequence of the Cas9 protein comprises at least one, at least two, at least three, at least four, at least five, at least six, or at least seven mutations selected from the group consisting of amino acid residues 262, 267, 294, 405, 409, 480, 543, 694, 1219, 1224, 1256, and 1362 of the amino acid sequence provided in SEQ ID NO: 9, wherein the amino acid sequence of the recombinant Cas9 protein is not identical to the amino acid sequence of a naturally occurring Cas9 protein, and wherein the recombinant Cas9 protein exhibits increased activity on a target sequence that does not comprise the canonical PAM sequence (5′-NGG-3′) at its 3′ end as compared to Streptococcus pyogenes Cas9 as provided in SEQ ID NO: 9. In some embodiments, the Streptococcus pyogenes Cas9 comprises a RuvC and an HNH domain. In other embodiments, the Cas9 protein comprises at least one, at least two, at least three, at least four, at least five, at least six, or at least seven mutations selected from the group consisting of amino acid residues 122, 137, 182, 262, 294, 409, 480, 543, 660, 694, 1219, and 1329 of the amino acid sequence provided in SEQ ID NO: 9

As one example, the Cas9 protein may exhibit increased binding to the target sequence, may exhibit increased nuclease activity at the target sequence, or may exhibit an increase in other activities, depending on whether the Cas 9 protein is fused to an additional domain, such as an enzyme that has enzymatic activity. In some embodiments, the enzymatic activity modifies a target DNA. In some embodiments, the enzymatic activity is nuclease activity, methyltransferase activity, demethylase activity, DNA repair activity, DNA damage activity, deamination activity, dismutase activity, alkylation activity, depurination activity, oxidation activity, pyrimidine dimer forming activity, integrase activity, transposase activity, recombinase activity, polymerase activity, ligase activity, helicase activity, photolyase activity or glycosylase activity. In some cases, the enzymatic activity is nuclease activity. In some cases, the nuclease activity introduces a double strand break in the target DNA. In some cases, the enzymatic activity modifies a target polypeptide associated with the target DNA. In some cases, the enzymatic activity is methyltransferase activity, demethylase activity, acetyltransferase activity, deacetylase activity, kinase activity, phosphatase activity, ubiquitin ligase activity, deubiquitinating activity, adenylation activity, deadenylation activity, SUMOylating activity, deSUMOylating activity, ribosylation activity, deribosylation activity, myristoylation activity or demyristoylation activity. In some cases, the target polypeptide is a histone and the enzymatic activity is methyltransferase activity, demethylase activity, acetyltransferase activity, deacetylase activity, kinase activity, phosphatase activity, ubiquitin ligase activity or deubiquitinating activity.

In some embodiments, any of the Cas9 protein is fused to a protein that has an enzymatic activity. In some embodiments, the enzymatic activity modifies a polypeptide associated with DNA (e.g. a histone). In some embodiments, the enzymatic activity is methyltransferase activity, demethylase activity, acetyltransferase activity, deacetylase activity, kinase activity, phosphatase activity, ubiquitin ligase activity (i.e., ubiquitination activity), deubiquitinating activity, adenylation activity, deadenylation activity, SUMOylating activity, deSUMOylating activity, ribosylation activity, deribosylation activity, myristoylation activity, demyristoylation activity glycosylation activity (e.g., from O-GlcNAc transferase) or deglycosylation activity. The enzymatic activities listed herein catalyze covalent modifications to proteins. Such modifications are known in the art to alter the stability or activity of the target protein (e.g., phosphorylation due to kinase activity can stimulate or silence protein activity depending on the target protein). Of particular interest as protein targets are histones. Histone proteins are known in the art to bind DNA and form complexes known as nucleosomes. Histones can be modified (e.g., by methylation, acetylation, ubuitination, phosphorylation) to elicit structural changes in the surrounding DNA, thus controlling the accessibility of potentially large portions of DNA to interacting factors such as transcription factors, polymerases and the like. A single histone can be modified in many different ways and in many different combinations (e.g., trimethylation of lysine 27 of histone 3, H3K27, is associated with DNA regions of repressed transcription while trimethylation of lysine 4 of histone 3, H3K4, is associated with DNA regions of active transcription). Thus, a site-directed modifying polypeptide with histone-modifying activity finds use in the site specific control of DNA structure and can be used to alter the histone modification pattern in a selected region of target DNA. Such methods find use in both research and clinical applications.

In some embodiments, the Cas9 protein exhibits activity on a target sequence having a 3′ end that is not directly adjacent to, or does not have the canonical PAM sequence (5′-NGG-3′), that is at least 2-fold, at least 3-fold, at least 5-fold, at least 10-fold, at least 50-fold, at least 100-fold, at least 500-fold, at least 1,000-fold, at least 5,000-fold, at least 10,000-fold, at least 50,000-fold, at least 100,000-fold, at least 500,000-fold, or at least 1,000,000-fold increased as compared to the activity of Streptococcus pyogenes Cas9 as provided by SEQ ID NO: 9 on the same target sequence.

In some embodiments, the 3′-end of the target sequence is directly adjacent to an AGC, GAG, TTT, GTG, CAA CAC, GAT, TAA, ACG, CGA, or CGT sequence.

In some embodiments, the Cas9 protein activity is measured by a nuclease assay or a nucleic acid binding assay, which are known in the art and would be apparent to the skilled artisan. As provided herein, the Cas9 protein may be fused to one or more domains that confer an activity to the protein, such as a nucleic acid editing activity (e.g., deaminase activity or transcriptional activation activity), which may be measured (e.g., by a deaminase assay or transcriptional activation assay). In some embodiments, the Cas9 protein is fused to a deaminase domain and its activity may be measured using a deaminase assay. In some embodiments, the Cas9 protein is fused to a transcriptional activation domain and its activity may be measured using a transcriptional activation assay, for example, reporter activation assay where the reporter, e.g., GFP or luciferase, among others, is expressed in response to Cas9 binding to a target sequence.

In some embodiments, the amino acid sequence of the Cas9 protein comprises any of the mutations provided herein. For example, in some embodiments, the amino acid sequence of the Cas9 protein comprises at least one, at least two, at least three, at least four, at least five, at least six, or at least seven mutations selected from the group consisting of X262T, X267G, X294R, X405I, X409I, X480K, X543D, X694I, X1219V, X1224K, X1256K, and X1362P of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid. In other embodiments, the mutations may be A262T, S267G, K294R, F405I, S409I, E480K, E543D, M694I, E1219V, N1224K, Q1256K, and L1362P of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262.

In some embodiments, the amino acid sequence of the Cas9 protein comprises any of the mutations provided herein. For example, in some embodiments, the amino acid sequence of the Cas9 protein comprises at least one, at least two, at least three, at least four, at least five, at least six, or at least seven mutations selected from the group consisting of X262T, X294R, X409I, X480K, X543D, X694I, and X1219V of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid. In other embodiments, the mutations may be A262T, K294R, S409I, E480K, E543D, M694I, or E1219V of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262.

In some embodiments, the amino acid sequence of the Cas9 protein comprises an X1219V mutation or an E1219V mutation of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid.

In some embodiments, the amino acid sequence of the Cas9 protein comprises an X480K mutation or an E480K mutation of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid.

In some embodiments, the amino acid sequence of the Cas9 protein comprises an X543D mutation or a E543D mutation of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid.

In some embodiments, the amino acid sequence of the Cas9 comprises the mutations X480K, X543D, and X1219V; or the mutations E480K, E543D, and E1219V of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid.

In some embodiments, the amino acid sequence of the Cas9 comprises the mutations X262T, X409I, X480K, X543D, X694I, and X1219V; or the mutations A262T, S409I, E480K, E543D, M694I, and E1219V of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid.

In some embodiments, the amino acid sequence of the Cas9 protein comprises the mutations X294R, X480K, X543D, X1219V, X1256K, and X1362P; or the mutations K294R, E480K, E543D, E1219V, Q1256K, and L1362P of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid.

In some embodiments, the amino acid sequence of the Cas9 protein comprises the mutations X294R, X480K, X543D, X1219V, and X1256K, or mutations K294R, E480K, E543D, E1219V, and Q1256K of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid.

In some embodiments, the amino acid sequence of the Cas9 protein comprises the mutations X267G, X294R, X480K, X543D, X1219V, X1224K, and X1256K; or the mutations S267G, K294R, E480K, E543DE1219V, N1224K, and Q1256K of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid.

In some embodiments, the amino acid sequence of the Cas9 protein comprises the mutations X262T, X405I, X409I, X480K, X543D, X694I, and X1219V; or the mutations A262T, F405I, S409I, E480K, E543D, M694I, and E1219V of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X represents any amino acid.

In some embodiments, the amino acid sequence of the HNH domain is at least 80%, at least 85%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to the amino acid sequence of the HNH domain of any of SEQ ID NOs: 9-262. In some embodiments, the amino acid sequence of the HNH domain is identical to the amino acid sequence of any of the HNH domains of SEQ ID NOs: 9-262.

In some embodiments, the amino acid sequence of the RuvC domain is at least 80%, at least 85%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to the amino acid sequence of the RuvC domain of any of SEQ ID NOs: 9-262. In some embodiments, the amino acid sequence of the RuvC domain is identical to the amino acid sequence of any of the RuvC domains of SEQ ID NOs: 9-262.

In some embodiments, the Cas9 protein comprises at D10A and/or a H840A mutation in the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262. In some embodiments, the Cas9 protein comprises a D10X 1 and/or a H840X 2 mutation of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262, wherein X 1 is any amino acid except for D, and wherein X 2 is any amino acid except for H. In some embodiments, the Cas9 protein comprises an D10A mutation of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262. In some embodiments, the Cas9 protein comprises an H at amino acid residue 840 of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding residue in any of the amino acid sequences provided in SEQ ID NOs: 10-262. In some embodiments, the Cas9 protein comprises an H840A mutation of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262. In some embodiments, the Cas9 protein comprises an D at amino acid residue 10 of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding residue in any of the amino acid sequences provided in SEQ ID NOS: 10-262.

Some aspects of this disclosure provide fusion proteins comprising a Cas9 protein as provided herein that is fused to a second protein, thus forming a fusion protein. In some embodiments, the second protein is fused to the N-terminus of the Cas9 protein. In some embodiments, the second protein is fused to the C-terminus of the Cas9 protein. In some embodiments, the Cas9 domain and the effector domain are fused via a linker. The linker may be as simple as a covalent bond, or it may be a polymeric linker many atoms in length. In certain embodiments, the linker is a polypeptide or based on amino acids. In other embodiments, the linker is not peptide-like. In certain embodiments, the linker is a covalent bond (e.g., a carbon-carbon bond, disulfide bond, carbon-heteroatom bond, etc.). In certain embodiments, the linker is a carbon-nitrogen bond of an amide linkage. In certain embodiments, the linker is a cyclic or acyclic, substituted or unsubstituted, branched or unbranched aliphatic or heteroaliphatic linker. In certain embodiments, the linker is polymeric (e.g., polyethylene, polyethylene glycol, polyamide, polyester, etc.). In certain embodiments, the linker comprises a monomer, dimer, or polymer of aminoalkanoic acid. In certain embodiments, the linker comprises an aminoalkanoic acid (e.g., glycine, ethanoic acid, alanine, beta-alanine, 3-aminopropanoic acid, 4-aminobutanoic acid, 5-pentanoic acid, etc.). In certain embodiments, the linker comprises a monomer, dimer, or polymer of aminohexanoic acid (Ahx). In certain embodiments, the linker is based on a carbocyclic moiety (e.g., cyclopentane, cyclohexane). In other embodiments, the linker comprises a polyethylene glycol moiety (PEG). In other embodiments, the linker comprises amino acids. In certain embodiments, the linker comprises a peptide. In certain embodiments, the linker comprises an aryl or heteroaryl moiety. In certain embodiments, the linker is based on a phenyl ring. The linker may included functionalized moieties to facilitate attachment of a nucleophile (e.g., thiol, amino) from the peptide to the linker. Any electrophile may be used as part of the linker. Exemplary electrophiles include, but are not limited to, activated esters, activated amides, Michael acceptors, alkyl halides, aryl halides, acyl halides, and isothiocyanates.

In some embodiments, the linker comprises a chemical group or molecule linking two molecules or moieties, e.g., two domains of a fusion protein, such as, for example, a nuclease-inactive Cas9 domain and a effector domain (e.g., a deaminase domain). In some embodiments, the linker comprises one or more amino acid residues. For example, the linker may comprise at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 25, 30, 35, 40, 45, 50, or more amino acid residues. In some embodiments, the linker is 3, 9, 16, or 21 amino acids in length. In some embodiments, the linker comprises a (GGGGS) n (SEQ ID NO: 5), a (G) n (SEQ ID NO: 5087), an (EAAAK) n (SEQ ID NO: 6), a (GGS) n (SEQ ID NO: 5088), an SGSETPGTSESATPES (SEQ ID NO: 7) (also referred to as XTEN), or an (XP) n (SEQ ID NO: 5089) motif, or a combination of any of these, wherein n is independently an integer between 1 and 30. In some embodiments, wherein the linker comprises a (GGS) 3 (SEQ ID NO: 5088) motif or a SGSETPGTSESATPES (SEQ ID NO: 7) (XTEN) motif.

Some aspects of this disclosure provide fusion proteins comprising a Cas9 protein as provided herein that is fused to a second protein, thus forming a fusion protein. In some embodiments, the second protein is fused to the N-terminus of the Cas9 protein. In some embodiments, the second protein is fused to the C-terminus of the Cas9 protein. In some embodiments, the Cas9 domain and the effector domain are fused via a nuclear localization sequence (NLS), for example a NLS comprising the amino acid sequence PKKKRKV (SEQ ID NO: 299), MDSLLMNRRKFLYQFKNVRWAKGRRETYLC (SEQ ID NO: 300), or SPKKKRKVEAS (SEQ ID NO: 284). In some embodiments, a NLS may be combined with any of the linkers listed above.

In some embodiments, the effector domain comprises an enzymatic domain. In some embodiments, the effector domain comprises a nuclease, a nickase, a recombinase, a deaminase, a methyltransferase, a methylase, an acetylase, an acetyltransferase, a transcriptional activator, or a transcriptional repressor domain, which may have nuclease activity, nickase activity, recombinase activity, deaminase activity, methyltransferase activity, methylase activity, acetylase activity, acetyltransferase activity transcriptional activation activity or transcriptional repression activity, respectively. In some embodiments, the effector domain is a effector domain. In some embodiments, the effector domain is a deaminase domain. In some embodiments, the deaminase is a cytosine deaminase or a cytidine deaminase. In some embodiments, the deaminase is an apolipoprotein B mRNA-editing complex (APOBEC) family deaminase. In some embodiments, the deaminase is an APOBEC1 deaminase. In some embodiments, the deaminase is an APOBEC2 deaminase. In some embodiments, the deaminase is an APOBEC3 deaminase. In some embodiments, the deaminase is an APOBEC3A deaminase. In some embodiments, the deaminase is an APOBEC3D deaminase. In some embodiments, the deaminase is an APOBEC3E deaminase. In some embodiments, the deaminase is an APOBEC3F deaminase. In some embodiments, the deaminase is an APOBEC3G deaminase. In some embodiments, the deaminase is an APOBEC3H deaminase. In some embodiments, the deaminase is an APOBEC4 deaminase. In some embodiments, the deaminase is an activation-induced deaminase (AID). In some embodiments, the effector domain is at least 80%, at least 85%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to the deaminase domain of any one of SEQ ID NOs: 263-281. In some embodiments, the deaminase is a cytidine deaminase. In some embodiments, the deaminase is an apolipoprotein B mRNA-editing complex (APOBEC) family de

CLAIMS

Claims ( 21 )

1 . A Cas9 protein comprising an amino acid sequence that is at least 80% identical to the amino acid sequence of a Cas9 protein as provided by any one of SEQ ID NOs: 9-262,

wherein the amino acid sequence of the Cas9 protein comprises at least one mutation in an amino acid residue selected from the group consisting of amino acid residues 267, 294, 405, 480, 543, 1219, 1224, 1256, and 1362 of the amino acid sequence provided in SEQ ID NO: 9, or in a corresponding amino acid residue in any of the amino acid sequences provided in SEQ ID NOS: 10-262, and wherein the amino acid sequence of the Cas9 protein is not identical to the amino acid sequence of a naturally occurring Cas9 protein.

2 - 434 . (canceled)

435 . The Cas9 protein of claim 1 , wherein the Cas9 protein comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262.

436 . The Cas9 protein of claim 1 , wherein the amino acid sequence of the Cas9 protein comprises at least one mutation selected from the group consisting of S267G, K294R, F405I, E480K, E543D, E1219V, N1224K, Q1256K, and L1362P in the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262.

437 . The Cas9 protein of claim 1 , wherein the amino acid sequence of the Cas9 protein comprises a K294R mutation in the amino acid sequence provided in SEQ ID NO: 9 and further comprises at least one mutation selected from the group consisting of S267G, F405I, E480K, E543D, E1219V, N1224K, Q1256K, and L1362P in the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOS: 10-262.

438 . The Cas9 protein of claim 1 , wherein the amino acid sequence of the Cas9 protein comprises any one of the following groups of mutations:

K294R, E480K, E543D, E1219V, Q1256K, and L1362P; K294R, E480K, E543D, E1219V, and Q1256K; S267G, K294R, E480K, E543D, E1219V, N1224K, and Q1256K; R115H, K141Q, S267G, K294R, Q394H, E480K, E543D, E1219V, and Q1256K; S267G, K294R, E480K, E543D, E1219V, and Q1256K; D257N, S267G, K294R, T466A, E480K, E543D, 11063V, E1219V, and Q1256K; K294R, E480K, E543D, A711E, E1219V, and Q1256K; P230S, S267G, K294R, E480K, E543D, E1219V, and Q1256K; P230F, S267G, K294R, E480K, E543D, E1219V, and Q1256K; K294R, E480K, E543D, A711E, E1207G, E1219V, and Q1256K; or N175T, S267G, K294R, E480K, E543D, E1219V, and Q1256K;

in the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262.

439 . The Cas9 protein of claim 1 , wherein the Cas9 protein comprises a D10A and/or a H840A mutation of the amino acid sequence provided in SEQ ID NO: 9, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 10-262.

440 . The Cas9 protein of claim 1 , wherein the Cas9 protein recognizes a non-canonical PAM sequence.

441 . The Cas9 protein of claim 440 , wherein the non-canonical PAM sequence is selected from the group consisting of AAA, AAC, AAG, AAT, CAA, CAC, CAG, CAT, GAA, GAC, GAG, GAT, TAA, TAC, TAG, TAT, ACA, ACC, ACG, ACT, CCA, CCC, CCG, CCT, GCA, GCC, GCG, GCT, TCA, TCC, TCG, TCT, AGA, AGC, AGT, CGA, CGC, CGT, GGA, GGC, GGT, TGA, TGC, TGT, ATA, ATC, ATG, ATT, CTA, CTC, CTG, CTT, GTA, GTC, GTG, GTT, TTA, TTC, TTG, and TTT.

442 . A fusion protein comprising the Cas9 protein of claim 1 , wherein the Cas9 protein is fused to an effector domain.

443 . The fusion protein of claim 442 , wherein the effector domain comprises an enzyme domain.

444 . The fusion protein of claim 442 , wherein the effector domain comprises a nuclease domain, a nickase domain, a recombinase domain, a deaminase domain, a methyltransferase domain, a methylase domain, an acetylase domain, an acetyltransferase domain, a transcriptional activator domain, or a transcriptional repressor domain.

445 . The fusion protein of claim 442 , wherein the effector domain is a nuclease domain.

446 . A dimer of the fusion protein of claim 445 .

447 . A fusion protein comprising a first Cas9 protein fused to a second Cas9 protein, wherein the first Cas9 protein is the Cas9 protein of claim 1 .

448 . A complex comprising the Cas9 protein of claim 1 and a guide RNA bound to the Cas9 protein.

449 . A complex comprising the fusion protein of claim 447 ,

a first guide RNA bound to the first Cas9 protein of the fusion protein, and a second guide RNA bound to the second Cas9 protein of the fusion protein.

450 . A method comprising contacting a DNA molecule with the Cas9 protein of claim 1 and a guide RNA, wherein the guide RNA is about 15-100 nucleotides long and comprises a sequence of at least 10 contiguous nucleotides that is complementary to a target sequence.

451 . A polynucleotide encoding the Cas9 protein of claim 1 .

452 . A vector comprising the polynucleotide of claim 451 .

453 . A cell comprising the Cas9 protein of claim 1 , wherein the cell is an isolated cell.

US18/732,559

2015-10-23

2024-06-03

Evolved cas9 proteins for gene editing

Pending

US20250092374A1

( en )

Priority Applications (1)

Application Number

Priority Date

Filing Date

Title

US18/732,559

US20250092374A1

( en )

2015-10-23

2024-06-03

Evolved cas9 proteins for gene editing

Applications Claiming Priority (12)

Application Number

Priority Date

Filing Date

Title

US201562245828P

2015-10-23

2015-10-23

US201662279346P

2016-01-15

2016-01-15

US201662311763P

2016-03-22

2016-03-22

US201662322178P

2016-04-13

2016-04-13

US201662357352P

2016-06-30

2016-06-30

US201662357332P

2016-06-30

2016-06-30

US201662370700P

2016-08-03

2016-08-03

US201662398490P

2016-09-22

2016-09-22

US201662408686P

2016-10-14

2016-10-14

PCT/US2016/058345

WO2017070633A2

( en )

2015-10-23

2016-10-22

Evolved cas9 proteins for gene editing

US201815770076A

2018-04-20

2018-04-20

US18/732,559

US20250092374A1

( en )

2015-10-23

2024-06-03

Evolved cas9 proteins for gene editing

Related Parent Applications (2)

Application Number

Title

Priority Date

Filing Date

US15/770,076

Continuation

US12043852B2

( en )

2015-10-23

2016-10-22

Evolved Cas9 proteins for gene editing

PCT/US2016/058345

Continuation

WO2017070633A2

( en )

2015-10-23

2016-10-22

Evolved cas9 proteins for gene editing

Publications (1)

Publication Number

Publication Date

US20250092374A1

true

US20250092374A1 ( en )

2025-03-20

Family

ID=57249890

Family Applications (6)

Application Number

Title

Priority Date

Filing Date

US15/770,076

Active

2040-12-02

US12043852B2

( en )

2015-10-23

2016-10-22

Evolved Cas9 proteins for gene editing

US15/331,852

Active

US10167457B2

( en )

2015-10-23

2016-10-22

Nucleobase editors and uses thereof

US15/960,171

Active

2037-07-25

US11214780B2

( en )

2015-10-23

2018-04-23

Nucleobase editors and uses thereof

US17/527,011

Active

2038-01-02

US12344869B2

( en )

2015-10-23

2021-11-15

Nucleobase editors and uses thereof

US18/732,559

Pending

US20250092374A1

( en )

2015-10-23

2024-06-03

Evolved cas9 proteins for gene editing

US19/202,976

Pending

US20250270527A1

( en )

2015-10-23

2025-05-08

Nucleobase editors and uses thereof

Family Applications Before (4)

Application Number

Title

Priority Date

Filing Date

US15/770,076

Active

2040-12-02

US12043852B2

( en )

2015-10-23

2016-10-22

Evolved Cas9 proteins for gene editing

US15/331,852

Active

US10167457B2

( en )

2015-10-23

2016-10-22

Nucleobase editors and uses thereof

US15/960,171

Active

2037-07-25

US11214780B2

( en )

2015-10-23

2018-04-23

Nucleobase editors and uses thereof

US17/527,011

Active

2038-01-02

US12344869B2

( en )

2015-10-23

2021-11-15

Nucleobase editors and uses thereof

Family Applications After (1)

Application Number

Title

Priority Date

Filing Date

US19/202,976

Pending

US20250270527A1

( en )

2015-10-23

2025-05-08

Nucleobase editors and uses thereof

Country Status (10)

Country

Link

US

( 6 )

US12043852B2

( en )

EP

( 4 )

EP4269577A3

( en )

JP

( 6 )

JP7067793B2

( en )

KR

( 1 )

KR20180069898A

( en )

CN

( 2 )

CN108699116A

( en )

AU

( 2 )

AU2016342380B2

( en )

CA

( 1 )

CA3002827A1

( en )

IL

( 4 )

IL258821B

( en )

SG

( 2 )

SG10202104041PA

( en )

WO

( 2 )

WO2017070633A2

( en )

Cited By (5)

* Cited by examiner, † Cited by third party

Publication number

Priority date

Publication date

Assignee

Title

US12473543B2

( en )

2019-04-17

2025-11-18

The Broad Institute, Inc.

Adenine base editors with reduced off-target effects

US12516308B2

( en )

2017-03-09

2026-01-06

President And Fellows Of Harvard College

Suppression of pain by gene editing

US12522807B2

( en )

2018-07-09

2026-01-13

The Broad Institute, Inc.

RNA programmable epigenetic RNA modifiers and uses thereof

US12570972B2

( en )

2019-03-19

2026-03-10

The Broad Institute, Inc.

Methods and compositions for prime editing nucleotide sequences

US12584118B2

( en )

2013-09-06

2026-03-24

President And Fellows Of Harvard College

Cas9 variants and uses thereof

Families Citing this family (533)

* Cited by examiner, † Cited by third party

Publication number

Priority date

Publication date

Assignee

Title

WO2011140441A2

( en )

2010-05-06

2011-11-10

Children's Hospital Medical Center

Methods and systems for converting precursor cells into intestinal tissues through directed differentiation

CA2825370A1

( en )

2010-12-22

2012-06-28

President And Fellows Of Harvard College

Continuous directed evolution

WO2013066438A2

( en )

2011-07-22

2013-05-10

President And Fellows Of Harvard College

Evaluation and improvement of nuclease cleavage specificity

WO2013163628A2

( en )

2012-04-27

2013-10-31

Duke University

Genetic correction of mutated genes

US9828582B2

( en )

2013-03-19

2017-11-28

Duke University

Compositions and methods for the induction and tuning of gene expression

US20150044192A1

( en )

2013-08-09

2015-02-12

President And Fellows Of Harvard College

Methods for identifying a target site of a cas9 nuclease

US9359599B2

( en )

2013-08-22

2016-06-07

President And Fellows Of Harvard College

Engineered transcription activator-like effector (TALE) domains and uses thereof

US9340799B2

( en )

2013-09-06

2016-05-17

President And Fellows Of Harvard College

MRNA-sensing switchable gRNAs

US9526784B2

( en )

2013-09-06

2016-12-27

President And Fellows Of Harvard College

Delivery system for functional nucleases

US20150166984A1

( en )

2013-12-12

2015-06-18

President And Fellows Of Harvard College

Methods for correcting alpha-antitrypsin point mutations

EP3097196B1

( en )

2014-01-20

2019-09-11

President and Fellows of Harvard College

Negative selection and stringency modulation in continuous evolution systems

EP3115457B1

( en )

2014-03-05

2019-10-02

National University Corporation Kobe University

Genomic sequence modification method for specifically converting nucleic acid bases of targeted dna sequence, and molecular complex for use in same

EP3712254A1

( en )

2014-05-28

2020-09-23

Children's Hospital Medical Center

Methods and systems for converting precursor cells into gastric tissues through directed differentiation

EP3919621A1

( en )

2014-06-23

2021-12-08

The General Hospital Corporation

Genomewide unbiased identification of dsbs evaluated by sequencing (guide-seq)

WO2016022363A2

( en )

2014-07-30

2016-02-11

President And Fellows Of Harvard College

Cas9 proteins including ligand-dependent inteins

AU2015330699B2

( en )

2014-10-10

2021-12-02

Editas Medicine, Inc.

Compositions and methods for promoting homology directed repair

WO2016077052A2

( en )

2014-10-22

2016-05-19

President And Fellows Of Harvard College

Evolution of proteases

WO2016073990A2

( en )

2014-11-07

2016-05-12

Editas Medicine, Inc.

Methods for improving crispr/cas-mediated genome-editing

JP6929791B2

( en )

2015-02-09

2021-09-01

デューク ユニバーシティ

Compositions and methods for epigenome editing

JP6817215B2

( en )

2015-03-03

2021-01-20

ザ ジェネラル ホスピタル コーポレイション

Genetically engineered CRISPR-Cas9 nuclease with modified PAM specificity

US11299729B2

( en )

2015-04-17

2022-04-12

President And Fellows Of Harvard College

Vector-based mutagenesis system

EP3294896A1

( en )

2015-05-11

2018-03-21

Editas Medicine, Inc.

Optimized crispr/cas9 systems and methods for gene editing in stem cells

KR102796744B1

( en )

2015-06-09

2025-04-15

에디타스 메디신, 인코포레이티드

CRISPR/CAS-related methods and compositions for improving transplantation

JP7044373B2

( en )

2015-07-15

2022-03-30

ラトガース,ザ ステート ユニバーシティ オブ ニュージャージー

Nuclease-independent targeted gene editing platform and its uses

WO2017015545A1

( en )

2015-07-22

2017-01-26

President And Fellows Of Harvard College

Evolution of site-specific recombinases

WO2017015559A2

( en )

2015-07-23

2017-01-26

President And Fellows Of Harvard College

Evolution of bt toxins

WO2017019895A1

( en )

2015-07-30

2017-02-02

President And Fellows Of Harvard College

Evolution of talens

DK3348638T3

( en )

2015-09-09

2023-02-13

Univ Kobe Nat Univ Corp

METHOD OF CONVERTING GENOME SEQUENCE FROM GRAM-POSITIVE BACTERIA BY SPECIFICALLY CONVERTING NUCLEIC ACID BASE INTO THE INTENDED DNA SEQUENCE, AND MOLECULAR COMPLEX USED THEREFOR

EP3353296B1

( en )

2015-09-24

2020-11-04

Editas Medicine, Inc.

Use of exonucleases to improve crispr/cas-mediated genome editing

EP4089175A1

( en )

2015-10-13

2022-11-16

Duke University

Genome engineering with type i crispr systems in eukaryotic cells

SG10202104041PA

( en )

2015-10-23

2021-06-29

Harvard College

Nucleobase editors and uses thereof

WO2017090761A1

( en )

*

2015-11-27

2017-06-01

国立大学法人神戸大学

Method for converting monocot plant genome sequence in which nucleic acid base in targeted dna sequence is specifically converted, and molecular complex used therein

WO2017095967A2

( en )

2015-11-30

2017-06-08

Duke University

Therapeutic targets for the correction of the human dystrophin gene by gene editing and methods of use

US11597924B2

( en )

2016-03-25

2023-03-07

Editas Medicine, Inc.

Genome editing systems comprising repair-modulating enzyme molecules and methods of their use

EP3443081A4

( en )

2016-04-13

2019-10-30

Duke University

CRISPR / CAS9-BASED REPRESSORS TO INACTIVATE IN VIVO GENE TARGETS AND METHODS OF USE

WO2017180694A1

( en )

2016-04-13

2017-10-19

Editas Medicine, Inc.

Cas9 fusion molecules gene editing systems, and methods of use thereof

CN109312329B

( en )

*

2016-04-21

2023-11-21

国立大学法人神户大学

Methods for improving mutation introduction efficiency in genome sequence modification technology, and molecular complexes used therefor

CA3029132A1

( en )

2016-07-06

2018-01-11

Vertex Pharmaceuticals Incorporated

Materials and methods for treatment of pain related disorders

US11459587B2

( en )

2016-07-06

2022-10-04

Vertex Pharmaceuticals Incorporated

Materials and methods for treatment of pain related disorders

EP4275747A3

( en )

2016-07-19

2024-01-24

Duke University

Therapeutic applications of cpf1-based genome editing

US11168313B2

( en )

2016-07-26

2021-11-09

The General Hospital Corporation

Variants of CRISPR from Prevotella and Francisella 1 (Cpf1)

KR20250103795A

( en )

2016-08-03

2025-07-07

프레지던트 앤드 펠로우즈 오브 하바드 칼리지

Adenosine nucleobase editors and uses thereof

US11661590B2

( en )

2016-08-09

2023-05-30

President And Fellows Of Harvard College

Programmable CAS9-recombinase fusion proteins and uses thereof

WO2018039438A1

( en )

2016-08-24

2018-03-01

President And Fellows Of Harvard College

Incorporation of unnatural amino acids into proteins using base editing

WO2018052247A1

( en )

*

2016-09-13

2018-03-22

주식회사 툴ì

Method for identifying dna base editing by means of cytosine deaminase

SG11201903089RA

( en )

2016-10-14

2019-05-30

Harvard College

Aav delivery of nucleobase editors

SG11201903697WA

( en )

2016-11-04

2019-05-30

Childrens Hospital Med Ct

Liver organoid compositions and methods of making and using same

WO2018086623A1

( en )

2016-11-14

2018-05-17

Institute Of Genetics And Developmental Biology, Chinese Academy Of Sciences

A method for base editing in plants

RU2768043C2

( en )

2016-11-14

2022-03-23

Тулджен Инкорпорейтед

Artificially created sc function control system

CN107043779B

( en )

*

2016-12-01

2020-05-12

中国农业科学院作物科学研究所

Application of a CRISPR/nCas9-mediated site-directed base replacement in plants

US11192929B2

( en )

*

2016-12-08

2021-12-07

Regents Of The University Of Minnesota

Site-specific DNA base editing using modified APOBEC enzymes

WO2018119010A1

( en )

2016-12-19

2018-06-28

Editas Medicine, Inc.

Assessing nuclease cleavage

WO2018119359A1

( en )

2016-12-23

2018-06-28

President And Fellows Of Harvard College

Editing of ccr5 receptor gene to protect against hiv infection

US20200385753A1

( en )

*

2016-12-23

2020-12-10

Institute For Basic Science

Composition for base editing for animal embryo and base editing method

CA3048479A1

( en )

2016-12-23

2018-06-28

President And Fellows Of Harvard College

Gene editing of pcsk9

JP7219972B2

( en )

2017-01-05

2023-02-09

ラトガース,ザ ステート ユニバーシティ オブ ニュー ジャージー

DNA double-strand break-independent targeted gene editing platform and its applications

EP3565907B1

( en )

2017-01-06

2022-05-04

Editas Medicine, Inc.

Methods of assessing nuclease cleavage

IL268895B2

( en )

2017-02-28

2025-05-01

Vor Biopharma Inc

Compositions and methods for inhibiting proteins with specific binding

EP3592381A1

( en )

2017-03-09

2020-01-15

President and Fellows of Harvard College

Cancer vaccine

WO2018165629A1

( en )

2017-03-10

2018-09-13

President And Fellows Of Harvard College

Cytosine to guanine base editor

WO2018176009A1

( en )

2017-03-23

2018-09-27

President And Fellows Of Harvard College

Nucleobase editors comprising nucleic acid programmable dna binding proteins

EP3609997A4

( en )

2017-04-14

2021-03-03

Children's Hospital Medical Center

Multi donor stem cell compositions and methods of making same

ES2992912T3

( en )

2017-04-21

2024-12-19

Massachusetts Gen Hospital

Variants of cpf1 (cas12a) with altered pam specificity

US11499151B2

( en )

2017-04-28

2022-11-15

Editas Medicine, Inc.

Methods and systems for analyzing guide RNA molecules

BR112019023377A2

( en )

2017-05-11

2020-06-16

Institute Of Genetics And Developmental Biology, Chinese Academy Of Sciences

CREATING A HERBICIDE RESISTANT GENE AND USE THE SAME

WO2018209320A1

( en )

2017-05-12

2018-11-15

President And Fellows Of Harvard College

Aptazyme-embedded guide rnas for use with crispr-cas9 in genome editing and transcriptional activation

US12297436B2

( en )

2017-05-18

2025-05-13

The Broad Institute, Inc.

Systems, methods, and compositions for targeted nucleic acid editing

AU2018273986A1

( en )

*

2017-05-25

2019-12-12

The General Hospital Corporation

Bipartite base editor (BBE) architectures and type-II-C-Cas9 zinc finger editing

US20200140835A1

( en )

*

2017-06-06

2020-05-07

The General Hospital Corporation

Engineered CRISPR-Cas9 Nucleases

JP7518620B2

( en )

2017-06-09

2024-07-18

エディタス・メディシン,インコーポレイテッド

Engineered CAS9 nuclease

CN109136272A

( en )

*

2017-06-15

2019-01-04

中山大学

Base editing system, method, kit and its application in people's system genitale of the mutation of people's HBB gene are repaired for specificity

CN108823202A

( en )

*

2017-06-15

2018-11-16

中山大学

Base editing system, method, kit and its application of the mutation of people's HBB gene are repaired for specificity

US20200248169A1

( en )

*

2017-06-26

2020-08-06

The Broad Institute, Inc.

Crispr/cas-cytidine deaminase based compositions, systems, and methods for targeted nucleic acid editing

WO2019010164A1

( en )

2017-07-06

2019-01-10

President And Fellows Of Harvard College

EVOLUTION OF ARNT SYNTHÉTASES

BR112020000310A2

( en )

*

2017-07-07

2020-07-14

Toolgen Incorporated

specific target crispr variants

WO2019014564A1

( en )

2017-07-14

2019-01-17

Editas Medicine, Inc.

Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites

CA3106738C

( en )

*

2017-07-25

2025-02-11

Shanghai Institutes For Biological Sciences, Chinese Academy Of Sciences

Method for modulating rna splicing by inducing base mutation at splice site or base substitution in polypyrimidine region

CN111801345A

( en )

*

2017-07-28

2020-10-20

哈佛大学的校长及成员们

Methods and compositions for evolutionary base editors using phage-assisted sequential evolution (PACE)

CN120989074A

( en )

*

2017-07-31

2025-11-21

映像生物有限公司

Cell models of eye diseases and their applications in therapies for eye diseases

CN107619833B

( en )

*

2017-08-14

2021-03-02

华中农业大学

Plasmid pZF17-30 for constructing Brucella mutant strain and its construction method and application

CN111263810A

( en )

2017-08-22

2020-06-09

纳匹基因公司

Organelle genome modification using polynucleotide directed endonucleases

CA3073448A1

( en )

*

2017-08-23

2019-02-28

The General Hospital Corporation

Engineered crispr-cas9 nucleases with altered pam specificity

WO2019040935A1

( en )

2017-08-25

2019-02-28

President And Fellows Of Harvard College

Evolution of bont peptidases

EP3676376B1

( en )

2017-08-30

2025-01-15

President and Fellows of Harvard College

High efficiency base editors comprising gam

WO2019041296A1

( en )

*

2017-09-01

2019-03-07

上海科技大学

Base editing system and method

US11530396B2

( en )

2017-09-05

2022-12-20

The University Of Tokyo

Modified CAS9 protein, and use thereof

US11649442B2

( en )

2017-09-08

2023-05-16

The Regents Of The University Of California

RNA-guided endonuclease fusion polypeptides and methods of use thereof

WO2019056002A1

( en )

2017-09-18

2019-03-21

President And Fellows Of Harvard College

Continuous evolution for stabilized proteins

AU2018338318B2

( en )

2017-09-21

2022-12-22

Massachusetts Institute Of Technology

Systems, methods, and compositions for targeted nucleic acid editing

US12297457B2

( en )

2017-10-10

2025-05-13

Children's Hospital Medical Center

Esophageal tissue and/or organoid compositions and methods of making same

US11795443B2

( en )

2017-10-16

2023-10-24

The Broad Institute, Inc.

Uses of adenosine base editors

WO2019135816A2

( en )

*

2017-10-23

2019-07-11

The Broad Institute, Inc.

Novel nucleic acid modifiers

US20210130800A1

( en )

*

2017-10-23

2021-05-06

The Broad Institute, Inc.

Systems, methods, and compositions for targeted nucleic acid editing

CN107841509B

( en )

*

2017-12-06

2021-03-23

南方医科大学南方医院

Kit for knocking out glioblastoma DHC2 gene

CN111801417B

( en )

2017-12-14

2024-10-29

克里斯珀医疗股份公司

New RNA-programmable endonuclease system and its use in genome editing and other applications

WO2019118949A1

( en )

2017-12-15

2019-06-20

The Broad Institute, Inc.

Systems and methods for predicting repair outcomes in genetic engineering

EP3728595A1

( en )

2017-12-21

2020-10-28

CRISPR Therapeutics AG

Materials and methods for treatment of usher syndrome type 2a and/or non-syndromic autosomal recessive retinitis pigmentosa (arrp)

EP3727394A4

( en )

2017-12-21

2021-09-08

Children's Hospital Medical Center

DIGITIZED HUMAN ORGANOIDS AND METHODS OF USING THEM

EP3728594A1

( en )

2017-12-21

2020-10-28

CRISPR Therapeutics AG

Materials and methods for treatment of usher syndrome type 2a

WO2019126709A1

( en )

2017-12-22

Related documents

Record · ID 607206
Conceptio Open Knowledge Archive — every document is proof-bundled with source, license, and retrieval metadata.