Conceptio › Archive › Project Gutenberg
Project Gutenbergpublic full text

In Caverns Below

Coblentz, Stanton A. (Stanton Arthur), 1896-1982; Paul, Frank R. (Frank Rudolph), 1884-1963 [Illustrator]
Project Gutenberg · Books · License: Public Domain
Open Source ↗
earthplanet)imaginaryplacesnevadasciencefiction
Science fiction, Earthquakes -- Fiction, Nevada -- Fiction, Imaginary places -- Fiction, Earth (Planet) -- Internal structure -- Fiction, Imaginary societies -- Fiction
This document is indexed with metadata only — full text is not available in the archive for this record. Open the official source ↗
Record · ID 61506
Retrieved via Conceptio — every document is proof-bundled with source, license, and retrieval metadata.