Conceptio › Archive › Project Gutenberg
Project Gutenbergpublic full text

Gold

O'Neill, Eugene, 1888-1953
Project Gutenberg · Books · License: Public Domain
Open Source ↗
dramafamiliesshipcaptainsshipwrecksurvival
Families -- Drama, Shipwreck survival -- Drama, Ship captains -- Drama, Greed -- Drama, Guilt -- Drama
This document is indexed with metadata only — full text is not available in the archive for this record. Open the official source ↗
Record · ID 64125
Retrieved via Conceptio — every document is proof-bundled with source, license, and retrieval metadata.