Conceptio › Archive › ClinicalTrials.gov
ClinicalTrials.govpublic full text

Telephone Call From Acute Care Physicians to Long Term Care Physicians: Impact on Transitional Care of Elderly Patients

Maimonides Medical Center
ClinicalTrials.gov · Datasets · License: Public Domain
Open Source ↗
alzheimer-diseasedysphagiafrailtyparkinson-disease
alzheimer disease, parkinson disease, dysphagia, alzheimer's d-se, parkinson's d-se, frailty, interventional, phase1
This document is indexed with metadata only — full text is not available in the archive for this record. Open the official source ↗

Related documents

Record · ID 969679
Retrieved via Conceptio — every document is proof-bundled with source, license, and retrieval metadata.