ConceptioArchiveClinicalTrials.gov
ClinicalTrials.govpublic full text

Efficacy of Vitamin D Supplementation in Obese Children

Columbia University · 2016
ClinicalTrials.gov · Datasets · License: Public Domain · 2016
Open Source ↗
childhoodnaobesitypediatricpediatricsvitamin-d-deficiency
obesity, pediatric, obesity, childhood, obesity, morbid, vitamin d deficiency, obesity, pediatrics, interventional, na
This document is indexed with metadata only — full text is not available in the archive for this record. Open the official source ↗

Related documents

Record · ID 995458
Retrieved via Conceptio — every document is proof-bundled with source, license, and retrieval metadata.